aoki




FC2EBODHODVSHKDKBIADNBLKLULUNACRAUKGFSDSSMVSDAWDMIDVCHRVSPRDSQTEDTTVENXMIAASSIS

2021-03-25
60 min

Caribbeancom 032521-001 Quick Shooting: The Best of Mika Aoki

  • mika aoki uncensoredcreampiecaribbeancom
    • 2021-03-05
    37 min

    [BTH-124]If You Cum On My Face My Husband Will Find Out...Please Try To Get It In My Mouth Miku Aoki

  • misaki aoki censoredmarried womanbukkakeBTHchobitchchovicBTH-124BTH124h-1435bth00124
    • 2021-02-19
    105 min

    [VEMA-156]Lusty Nursery School Teacher Preys On Doting Dads Rei Aoki

  • rei aoki censoredcreampiemature womanVEMAvenusbingo tamatsukamegami venusVEMA-156VEMA156vema00156
    • 2021-02-13
    73 min

    383REIW-045 Aoki-san

  • amateur censoredcreampiebig titsreiwreiw-045reiw045383reiw-045
    • 2021-02-01
    242 min

    [NACX-071]12 Bushy-Haired Mature Woman Babes With Fluffy Pussy Hair vol. 04

  • reiko ayukawa yuki seijyo censoredmature womanNACXplanet plusnanakuruNACX-071NACX071h-237nacx00071
    • 2021-01-11
    176 min

    1Pondo 011121_001 The Best 10 Of 2020: From 6 To 10 Mitsuha Kikukawa Momoka Ogawa Mikuro Komori Mika Aoki Riri Shiraki

  • amateur uncensored1pondo
    • 2020-12-05
    118 min

    [SHKD-918]Prison Fugitive Rei Aoki

  • rei aoki censoredsingle workSHKDattackerskazumasharkSHKD-918SHKD918shkd00918
    • 2020-12-04
    122 min

    [UMD-758]Hey Old Lady, Let Me Fuck You!! 6

  • oda mako rei aoki censoredbig titsblowjobUMDleodragon nishikawaUMD-758UMD758125umd00758
    • 2020-10-09
    64 min

    [YMDS-005]Amateurs Put Out At The Interview - They Only Came To Talk, But Before They Know It They're Taking A Quickie (28-Year-Old Juna) Juna Aoki

  • tamaki aoki censoredcreampieamateurYMDSmomotarou video publishingasakusa is jiroyoung peachYMDS-005YMDS005ymds00005
    • 2020-10-08
    98 min

    [ZEAA-054]BUKKAKE Married Woman: Group Semen Play With A Colleague's Wife - Rei Aoki

  • rei aoki censoredcreampiemature womanZEAAcenter villagetenunextreme center villageZEAA-054ZEAA054h-086zeaa00054
    • 2020-10-03
    158 min

    [JUL-332]A Gentle Smile, Bewitching G-Cup Titties, A Dignified And Beautiful Kamakura Lady. Juna Aoki 30 Years Old Her Adult Video Debut!!

  • tamaki aoki censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-332JUL332jul00332
    • 2020-09-25
    240 min

    [XRW-926]Oppai Mania Specialist Yui Boing Boing Big Tits 240 min.

  • yuri chitose rin aoki censoredcreampiebig titsXRWreal worksmanjiroreal real worksXRW-926XRW926172xrw00926
    • 2020-09-10
    240 min

    [HBAD-555]A Body That Aches After Surviving Her Husband And Cannot Resist The Desires Of Men / Dyed In Pink, A Widow's Secrets Of The Flesh

  • yuri sasahara kimishima mio censoredblowjobHBADhibinobabeHBAD-555HBAD5551hbad00555
    • 2020-09-09
    229 min

    [RETOMN-051]Metal Plate BEST OF BEST Masturbation 48 People

  • ayaka tomoda azusa itagaki censoredbeautiful girlRETOMNteppanteppan specialRETOMN-051RETOMN051
    • 2020-09-09
    228 min

    [RETOMN-001]Iron Blowjob - BEST Collection

  • azusa itagaki chika arimura censoredbig titsblowjobRETOMNteppanteppan specialRETOMN-001RETOMN001
    • 2020-09-09
    166 min

    [RETOMN-002]Iron Hands - Extreme Finger Banging Masturbation BEST Collection

  • azusa itagaki chika arimura censoredbig titsbeautiful girlRETOMNteppanteppan specialRETOMN-002RETOMN002
    • 2020-09-09
    229 min

    [RETOMN-015]Half-Conscious Intense Hardcore Piston SEX

  • ayaka tomoda ema kisaki haruki haruki kato censoredsquirtingbeautiful girlRETOMNteppanteppan specialRETOMN-015RETOMN015
    • 2020-09-09
    224 min

    [RETOMN-125]Knees Knocking! Hard Thrusting Standing Doggie Style 95 Girls BEST OF THE BEST

  • azusa itagaki erika censoredbig titsRETOMNteppanteppan specialRETOMN-125RETOMN125
    • 2020-09-09
    235 min

    [RETOMN-017]Accelerating Grind - Ultimate Cowgirl

  • azusa itagaki hibiki otsuki censoredbig titsbeautiful girlRETOMNteppanteppan specialRETOMN-017RETOMN017
    • 2020-09-06
    103 min

    [VEC-439]Sweaty Desires! An Old Lady Escaped Convict Creampie Fucked Me Rei Aoki

  • rei aoki censoredcreampiemature womanVECvenusbingo tamatsukamegami venusVEC-439VEC439vec00439
    • 2020-08-16
    112 min

    [VEC-435]It Was Just Supposed To Be One Night Of Infidelity... I Went On A Date Of Betrayal With My Husband's Employee, And I Knew I Shouldn't Have Fucked Him Rei Aoki

  • rei aoki censoredcreampiemature womanVECvenuspetermegami venusVEC-435VEC435vec00435
    • 2020-08-07
    122 min

    [UMD-743]Wife Swapping Hot Spring Trip 9

  • rei aoki amano tsubaki censoredmature womanhandjobUMDleoUMD-743UMD743125umd00743
    • 2020-07-17
    124 min

    [HZGD-158]A Saggy And Loose Pussy This Married Woman Felt The Shame Of Having A Loose Pussy, So She Decided To Firm Up Her Cunt And Got Hooked On Her Father-In-Law's Cock Rei Aoki

  • rei aoki censoredcreampiemarried womanHZGDmarried woman garden theaterhiroharu osakiimageHZGD-158HZGD158h-1100hzgd00158
    • 2020-07-10
    242 min

    [NASH-328]9 Married Women In Their 30's Have Creampie Sex With Other Men

  • kiriko kinosaki ayaka muto censoredcreampiemature womanNASHnadeshikoNASH-328NASH328h-067nash00328
    • 2020-07-05
    100 min

    [VAGU-230]The Bride's Mother Is Secretly Working At An Ultra High-Class Creampie-Specialty Mature Woman Soapland "Please Keep This A Secret From Everyone In The Family... Okay？" Rei Aoki

  • rei aoki censoredcreampiemarried womanVAGUvenuskitano majimeultimaVAGU-230VAGU230vagu00230
    • 2020-06-01
    243 min

    [NACX-054]62 Mature Women Keep Fucking With Their Hips In Cowgirl

  • haruna hana ayane shirotsuki censoredbig titsmature womanNACXplanet plusnanakuruNACX-054NACX054h-237nacx00054
    • 2020-05-31
    366 min

    [VEQ-173]The Super-Class Mature Woman Complete File Rei Aoki 6 Hours Chapter Two

  • rei aoki censoredcreampiemature womanVEQvenusmegami venusVEQ-173VEQ173veq00173
    • 2020-05-29
    241 min

    [NASH-301]Beautiful Proportions Mature Woman In Her 30s And Creampie Full Sex 10 Girls

  • rei aoki asagiri hikari censoredbig titsmature womanNASHnadeshikoNASH-301NASH301h-067nash00301
    • 2020-05-28
    67 min

    [052820-001]The Undisclosed: Standing Blowjob 2

  • ema kato uncensoredhandjobcaribbeancom
    • 2020-05-23
    240 min

    [MCSR-394]Apartment Wife Amazing Colossal Tits Special 4 Hours 20 Women

  • takeuchi sharina hikari hishino censoredcreampiebig titsMCSRbig morkalyokohachimascottMCSR-394MCSR39457mcsr00394
    • 2020-05-22
    28 min

    [BTH-033]Please Don't Look At Me With Such Pleading Eyes... Ms. Aoki Is Usually So Scary (LOL) Rei Aoki

  • rei aoki censoredblowjobsingle workBTHchobitchsuper bitchBTH-033BTH033h-1435bth00033
    • 2020-05-10
    120 min

    [VENU-933]A Beautiful Stepmom Spasmic Orgasmic Sex, But You Can't Make A Sound Rei Aoki

  • rei aoki censoredcreampiemarried womanVENUvenussaruincestVENU-933VENU933venu00933
    • 2020-04-17
    121 min

    [KSBJ-078]Perfect Support Rei Aoki

  • rei aoki censoredcreampiemature womanKSBJksb kikaku emmanuellebito sakuraKSBJ-078KSBJ078ksbj00078
    • 2020-04-11
    60 min

    [041120-001]Getting Up Sensitive Masochist Nipples 8

  • mika aoki uncensoredcreampiecaribbeancom
    • 2020-04-01
    242 min

    [NACX-050]It's A Tit Quake! Creampie Sex With Mature Ladies with Huge Tits: 10 Women

  • arisa hanyu hibikirin censoredbig titsmature womanNACXplanet plusnanakuruNACX-050NACX050h-237nacx00050
    • 2020-03-27
    243 min

    [NASH-263]My Sexy Mother-In-Law Is Hotter Than My Wife, So I Seduced Her... Forbidden Creampie Sex vol. 02

  • rei aoki shota chisato censoredcreampiemature womanNASHnadeshikoNASH-263NASH263h-067nash00263
    • 2020-03-15
    242 min

    [DDT-629]The Best Of Dirty Talking Titty Fucking Col 2

  • rin aoki shiori tsukada censoredbig titsslutDDTdogmaDDT-629DDT629ddt00629
    • 2020-03-14
    60 min

    [HEYZO-2216]Mika Aoki Exploring Every Corner Of Innocent Girl"s Body

  • mika aoki uncensoredcreampieheyzo
    • 2020-03-01
    120 min

    [NACR-309]A Sexually Frustrated Woman Seduces Her Father-In-Law - Rei Aoki

  • rei aoki censoredcreampiemature womanNACRplanet plusbito sakurananakuruNACR-309NACR309h-237nacr00309
    • 2020-02-09
    91 min

    [VEC-404]"Hey, Do You Want To Get Another Bottle Of Fun？" They Missed Their Last Train Home, And Now They Were Alone, Together... His Lady Boss Is Usually Really Mean, But When She Gets Silly She Becomes A Cute Girl, And Now She's Squirti

  • rei aoki censoredcreampiesquirtingVECvenuskaniemegami venusVEC-404VEC404vec00404
    • 2020-02-05
    121 min

    [OVG-124]Deep Kiss Handjob

  • hoshikawa rinhana nozomi hazuki censoredsluthandjobOVGglory questno directorOVG-124OVG12413ovg00124
    • 2020-01-24
    125 min

    [HKD-012]Back In Those Days, With A Beautiful Y********l In Uniform Haruka Momoi

  • misato aoki censoredmature womansingle workHKDdream ticketno directorno labelHKD-012HKD01217hkd00012
    • 2020-01-11
    58 min

    [011120-001]Debut Vol.55

  • mika aoki uncensoredcreampiecaribbeancom
    • 2020-01-09
    240 min

    [HBAD-518]The Ripe Beautiful Meat Of A Young Wife WHo Gets Tied Up And Wakes Up Wet With Desire

  • rei aoki atsushi konishi censoredbdsmHBADhibinobabeHBAD-518HBAD5181hbad00518
    • 2020-01-01
    126 min

    [GVH-003]Mother And Step-son Fuck: Rei Aoki

  • rei aoki censoredcreampiemomGVHglory questmametaro mamezawaGVH-003GVH00313gvh00003
    • 2020-01-01
    237 min

    [NACX-044]I-Cup Titties Or Bigger, Jiggling And Wiggling! 11 Colossal Tits Mature Woman Babes Having Sex

  • haruna hana arisa hanyu censoredbig titsmature womanNACXplanet plusnanakuruNACX-044NACX044h-237nacx00044
    • 2019-12-01
    110 min

    [VENU-900]"Are You Excited By My Panties？" - A Sexy Stepmom Squeezes Every Drop Of Cum Out Of Her Stepson's Cock - Rei Aoki

  • rei aoki censoredcreampiemature womanVENUvenusmajime kitanofakecest winntersVENU-900VENU900venu00900
    • 2019-11-02
    118 min

    [JUL-034]The Days Of Creampie Gang Bang Sex Will Never End Rei Aoki

  • rei aoki censoredcreampiemature womanJULmadonnamametaro mamezawaJUL-034JUL034jul00034
    • 2019-11-01
    245 min

    [ZMAR-003]She's Baring It All! Rin Aoki

  • rin aoki censoredcreampiebig titsZMARplanet plusthe whole damn thingZMAR-003ZMAR003h-237zmar00003
    • 2019-10-25
    240 min

    [XRW-771]S&M Big Vibrator Teasing! Cumming Hell With Lots Of Squirting 4 Hours

  • yui hatano kazama yumi censoredcreampiesquirtingXRWreal worksreal real worksXRW-771XRW771172xrw00771
    • 2019-10-03
    117 min

    [JUL-005]Mom's Friend Rei Aoki

  • rei aoki censoredmature womansingle workJULmadonnajyoji kawaiJUL-005JUL005jul00005
    • 2019-09-27
    239 min

    [XRW-755]Direct Brain Attack! Paralyzing Slutty Masturbation 4 Hours

  • shinoda yu ai mukai censoredbig titsschoolgirlXRWreal worksreal real worksXRW-755XRW755172xrw00755
    • 2019-08-03
    119 min

    [JUY-930]Rei Aoki Shows Off Her Suntanned Body!! She's A Married Fitness Instructor Who Tempts Men With Her Healthy Brown Skin

  • rei aoki censoredmature womanslutJUYmadonnarokusaburo mishimaJUY-930JUY930juy00930
    • 2019-08-01
    240 min

    [NACX-036]12 Bushy-Haired Mature Woman Babes With Fluffy Pussy Hair

  • yuki seijyo rei aoki censoredmature womanNACXplanet plusnanakuruNACX-036NACX036h-237nacx00036
    • 2019-07-04
    118 min

    [JUY-897]My Wife Can Never Know My Darkest Secret, I Impregnated My Own Stepmom... I Lost My Senses On Our Overnight Hot Springs Trip And Filled Her With A Load Of My Cum. Rei Aoki

  • rei aoki censoredcreampiemature womanJUYmadonnamametaro mamezawaJUY-897JUY897juy00897
    • 2019-06-29
    239 min

    [MIZD-143]Pantyhose/Total Domain/A Tight Skirt/A See-Through Bra/Panty Shot Action... Get Ready To Ejaculate To Hot Female Employees!! Super Selections Of The Best Office Ladies 4 Hours

  • momose yuri mizuno chaoyang censoredMIZDmoody smoodyz bestMIZD-143MIZD143mizd00143



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored