eri hosaka




FC2ROYDWANZAUKGVEMAMIDVNNPJJUFECESDDASDCAWDHODVMILKPREDHDKAGMEMHNDWAAASSISAUKGNATR

2020-10-16
76 min

[hoi-135]菜々(23)

  • amateur censoredbig titsamateurhoihoi-135hoi135hoi-135
    • 2020-10-22
    121 min

    [FSDSS-113]Super Luxurious Men's Massage Parlor FALENO: Now On Special! Ayaka Tomoda

  • ayaka tomoda censoredhandjobsingle workFSDSSfalenomusetafaleno starFSDSS-113FSDSS1131fsdss00113
    • 2020-11-03
    128 min

    [STARS-287]Aphrodisiac, Delicate Body, Hard Piston: Squirting And Pissing As She Cums So Hard She Loses Her Mind! Magic Potion Super Orgasm!! Ichika Nagano

  • ichika nagano censoredbeautiful girlsingle workSTARSsod createkaorusod starSTARS-287STARS2871stars00287
    • 2020-11-20
    104 min

    [SPRBD-039]I Like You, But/Nao Yuki

  • censoredbig titsbeautiful girlSPRBDintec incSPRBD-039SPRBD039h-706sprbd00039
    • 2020-11-27
    40 min

    FC2PPV 1586161 * Uncensored * First shot! !! Limited! !! Miraculous beautiful breasts E cup Honoka-chan, take off with SEX during life for the first time in life.

  • amateur uncensoredfc2
    • 2020-11-30
    59 min

    [mntj-038]ねね

  • amateur censoredbig titsamateurmntjmntj-038mntj038mntj-038
    • 2020-12-03
    54 min

    C0930 ki201203 Mikiko Nakayama 37years old

  • amateur uncensoredc0930
    • 2020-12-04
    43 min

    [oretd-813]白石さん

  • amateur censoredcreampieuniformoretdoretd-813oretd813oretd-813
    • 2020-12-05
    120 min

    [JUL-397]I Let Them Have My Wife In Secret... The Wannabe Cuckold Who Planned His Wife's Cheating Creampie Group Sex--Hinata Koizumi

  • hinata koizumi censoredcreampiebig titsJULmadonnatakeshi kogaJUL-397JUL397jul00397
    • 2020-12-11
    120 min

    [XRW-951]The Ultra Widow What Happened Next... Kanna Misaki

  • kanna misaki censoredsingle workXRWreal workshide kingdokuji picturesXRW-951XRW951172xrw00951
    • 2020-12-24
    119 min

    [RCTD-371]Naked Oil Kat Lesbian Fight 3

  • yuki sakuragi mari kaga censoredlesbianRCTDrocketscarecrowRCTD-371RCTD3711rctd00371
    • 2020-12-31
    123 min

    [JRZE-019]It's My First Time Filming My Affair Sanae Matsuyama

  • sanae matsuyama censoredcreampiemature womanJRZEcenter villagedaichi minamijurakuJRZE-019JRZE019h-086jrze00019
    • 2021-01-19
    59 min

    SIRO-4395 [First shot] [Shyness ..] [Healing whitening JD] Fair-skinned healing active JD culminates while being shy. Libido that has accumulated while waiting at home .. AV application on the net → AV experience shooting 1446

  • amateur censoredsquirtingamateursirosiro-4395siro4395siro-4395
    • 2021-01-22
    165 min

    [AOZ-295]Ravished In Both Holes - Married Woman With Breast Milk Followed And Made To Fuck

  • amateur censoredmarried womanAOZaozora softAOZ-295AOZ295
    • 2021-01-22
    135 min

    [ABW-048]Strictly Looking Up From Below Only: The Specially SK**led Town Beauty Suzu Matsuoka At The Retreat 16: I Will Do Anything To Please Our Guests

  • matsuoka tin censoredanalblowjobABWprestigecharlie nakataabsolutely wonderfulABW-048ABW048118abw00048
    • 2021-01-23
    120 min

    [MACB-021]美脚奥さんはチ●ポに飢えてる 結婚以来初めての他人棒と貪り合う濃厚セックス 弥生みづき

  • mizuki yayoi censoredsquirtingsingle workMACBsharkmedia cubeMACB-021MACB021h-687macb00021
    • 2021-01-30
    87 min

    300MAAN-621 [SSS class celebrity beauty x limit Iki barrage x vaginal cum shot 3 barrage] God erotic celebrity beauty with big breasts, nice ass, beautiful legs 3B appeared! Lick and suck while feeling! Pleasure greedy blowjob! Pursuit demon Ikase wi

  • amateur censoredcreampiebig titsmaanmaan-621maan621300maan-621
    • 2021-02-03
    120 min

    [GVH-191]Mom's Real Sex Education - Mayu Suzuki

  • suzuki mayu censoredbig titsmomGVHglory questkabin kizakuraGVH-191GVH19113gvh00191
    • 2021-02-06
    33 min

    FC2PPV 1675071 [Individual shooting ㊽] Prefectural K3 pregnant woman Ami ☆ Injecting sperm into the belly just before giving birth & blowjob in the car on the school road [with bonus]

  • amateur uncensoredfc2
    • 2021-02-09
    33 min

    FC2PPV 1679120 ☆ Half-price opening campaign ☆ 30-year-old beautiful mature woman with outstanding style again! Exposed play in the parking lot ♪ Creampie car SEX stealthily!

  • amateur uncensoredfc2
    • 2021-03-05
    122 min

    [UMD-771]Partied Out Married Women 3: When Her Husband Is Out... You Get Horny When You Party, Don't You, Mrs.？

  • nene tanaka kanon kanon censoredbig titsUMDleodragon nishikawaUMD-771UMD771125umd00771
    • 2021-03-06
    44 min

    10musume 030621_01 Walking With Remote Rotor: It feels so good I can’t walk anymore Akane Maruyama

  • amateur uncensored10musume
    • 2021-04-06
    62 min

    Pacopacomama 040621_456 I will sit down on the ground so please give me a cock!: Chino Ogata

  • amateur uncensoredpacopacomama
    • 2021-04-14
    216 min

    [HUNTA-990]I Caught Two Of My Hottest Female Coworkers Making Out! They Were Kissing And Fucking Passionately, And When They Saw Me, They Let Me Join Them! After Our Work Party Was Over, The Two Of Them Brought Me Home, Too...

  • censoredcreampielesbianHUNTAhuntervolvo nakanohhh groupHUNTA-990HUNTA990hunta00990
    • 2021-04-26
    42 min

    FC2PPV 1788676 * Until the end of the month, I tried NTR a female Anna class 19 year old I cup girl

  • amateur uncensoredfc2
    • 2021-04-27
    64 min

    490FAN-044 Shihori Part 1

  • amateur censoredcreampiebig titsfanfan-044fan044490fan-044
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-08
    145 min

    [MKMP-398]Male Subs Want Their Nipples Teased - Throbbing Teats Until They Blow Their Loads, Over And Over Again - Riho Fujimori

  • riho fujimori censoredbig titsslutMKMPk m producesamoarimillionMKMP-398MKMP398mkmp00398
    • 2021-05-08
    141 min

    [NKHB-003]Meaty & Busty Married Woman Lunchbox - Assorted Glorious Sluts - Yoshiko (35 Years Old)

  • censoredbig titsmature womanNKHBthe thick and meaty cafeteria the dayddozaemonNKHB-003NKHB003nkhb00003
    • 2021-05-28
    102 min

    [YST-246]This Sexually Frustrated Married Woman That I Became Friends With At A Remote Party Turned Out To Be A Pervert Who Wanted Dick

  • ichijo mio naoko akase censoredblowjobYSTkomyoYST-246YST246540yst00246
    • 2021-06-01
    140 min

    [KIRE-045]She Normally Masturbates At Least 7 Times A Week. This Married Woman Seaya Ichinose Has A Strong Libido! AV DEBUT

  • ayano ichinose censoredmature womansingle workKIREsod createyo sukerei kirei sodKIRE-045KIRE0451kire00045
    • 2021-06-06
    90 min

    300NTK-583 Active Gravure Superb Style G Breasts! !! Start from wearing erotic shooting! !! It is inevitable to induce a good desire in a swimsuit with no cloth area of a beautiful woman who can push it completely! !! Heat with sexy pose instruction!

  • amateur censoredcreampiebig titsntkntk-583ntk583300ntk-583
    • 2021-06-11
    151 min

    [IPX-680]No Longer A Teacher: I had A Secret Meeting After School. I Drowned In Lustful Sex With A S*****t So Young She Could Be My Daughter... Minami Aizawa

  • minami aizawa censoredschoolgirlblowjobIPXidea pocketdishIPX-680IPX680ipx00680
    • 2021-06-20
    240 min

    [SCPX-427]Seduced By My Sister-In-Law - He Never Had A Chance to Resist Her! Easy Cheating Creampie!

  • censoredcreampieSCPXscoopSCPX-427SCPX427scpx00427
    • 2021-06-27
    59 min

    200GANA-2512 Seriously Nampa, first shot. 1654 Picking Up A Kind And Nice Blonde White Gal! Excited and desperate for a bristle lewd gap that does not look good on the face! Sensitive Oma ● Ko repeats medium alive many times …

  • amateur censoredamateurganagana-2512gana2512200gana-2512
    • 2021-07-08
    20 min

    Caribbeancom 070821-001 Anal Encyclopedia : Reika Kudo

  • reika kudo uncensoredanalcaribbeancom
    • 2021-07-21
    68 min

    259LUXU-1443 Luxury Tv 1433 It’S Been 3 Months Since I Parted From My Ex-Boyfriend. A Beautiful Cabin Attendant Appears On Luxury Tv To Satisfy The Sexual Desire That Could Not Be Released! A Must-See For Beautiful Big Tits That Scatter Indecent

  • amateur censoredbig titsamateurluxuluxu-1443luxu1443259luxu-1443
    • 2021-08-18
    50 min

    FC2PPV 2042116 I Tried To Commit With Three People By Showing A String Swimsuit To A Shaved Pink Pussy Girl Similar To Yuri Nya

  • amateur uncensoredfc2
    • 2021-08-18
    29 min

    FC2PPV 2041953 Yuko-San’s Powder Option Practice That Left The Store: Menes’ Darkness Review Privilege That Such Things And Such Things Are Actually Unfolding In A Closed Room Is An Appearance Ver

  • amateur uncensoredfc2
    • 2021-09-09
    59 min

    1Pondo 090921_001 Lesbian Sex: Nana Nanase and Rena Hiiragi

  • amateur uncensored1pondo
    • 2021-09-18
    121 min

    [KSBJ-156]I Was Tempted By My Little Brother"s Super Horny Wife... Yuri Sasahara

  • yuri sasahara censoredcreampieblowjobKSBJksb kikaku emmanuellesakura ninKSBJ-156KSBJ156ksbj00156
    • 2021-09-22
    42 min

    396BIG-110 Hinano

  • amateur censoredcreampieschoolgirlbigbig-110big110396big-110
    • 2021-10-06
    120 min

    HHL-003 M.K (Mai Kagari)

  • amateur censoredamateurcosplayhhlhhl-003hhl003hhl-003
    • 2021-10-16
    92 min

    [SUJI-144]Creampie Sex With A Big Tits Beautiful Y********l In Uniform H-Cup Titties Riho Riho Takahashi

  • riho takahashi censoredcreampiebig titsSUJIkan ran monoSUJI-144SUJI144suji00144
    • 2021-10-21
    125 min

    [JURA-043]Wife Mitabi, First Time in Her 50s. Reiko Seo

  • reiko seo censoredcreampiemarried womanJURAcenter villagesouthern earthjurakuJURA-043JURA043h-086jura00043
    • 2021-10-29
    120 min

    [CAWD-310]Overly Respectable Super Slim Beautiful Girl Gets A Filthy Lesson. Locking Her Tight Skinny Body Down For Wet, Wild Teasing And Breaking In. Sumire Kuramoto

  • sumire kuramoto censoredsquirtingdeepthroatCAWDkawaiiarashiyama michiruCAWD-310CAWD310cawd00310
    • 2021-10-30
    215 min

    [HMNF-075]World Express, Bullet Tour: To Serina Island

  • censoredcreampieamateurHMNFhmjmcompany matsmanon fictionHMNF-075HMNF075h-172hmnf00075
    • 2021-11-09
    57 min

    H0930 ki211109 Kanae Takashiro 26years old

  • amateur uncensoredh0930
    • 2021-11-20
    60 min

    519MAZOF-025 [Absolutely Faceless NG] Private Math Teacher 28 Years Old [Student Eating Bristle Pussy] Excellent Style, Big Tits Teacher, Staying Trip With Legs On The Way Home From School 3 Days 3 Nights Saddle Madness, Masochist Called Metamorphosi

  • amateur censoredcreampiebig titsmazofmazof-025mazof025519mazof-025
    • 2021-11-29
    68 min

    [SHN-069]Touching OK! Girls 2021 Cosplay Girl Fucked At The Culture Festival And Her Hips Start Moving On Their Own

  • censoredbig titsblowjobSHNnatural highitaka smithlin powdernatsu carefully selected daughterSHN-069SHN0691shn00069
    • 2021-12-02
    693 min

    [AKDL-155]Amateur Year-end Special! "Can You Put Your Dick In Me？" We Interviewed And Fucked An Amateur Who Was Interested In Sex.

  • censoredamateurAKDLakinoriakinoriAKDL-155AKDL1551akdl00155
    • 2021-12-10
    176 min

    [SSIS-259]Result of Rushing, Hurrying, Panicking. Misaki Haraki"s Spirit Is Crushed And She Is Dying For Dick And Lewd SEX.

  • miharu hanasaki censoredbig titsbeautiful girlSSISs1 no 1 styletake dSSIS-259SSIS259ssis00259
    • 2021-12-17
    77 min

    380SQB-132 Himeka (Minato Himeka)

  • amateur censoredamateurbeautiful girlsqbsqb-132sqb132380sqb-132
    • 2021-12-25
    120 min

    [CEMD-104]I Bred A Sex Doll That Does What I Want Vol.7 Hana Shiramomo

  • white peach censoredcreampiemature womanCEMDceleb no tomoCEMD-104CEMD104cemd00104
    • 2021-12-27
    80 min

    [298HONB-233]外でしよッ

  • amateur censoredamateurhonbhonb-233honb233298honb-233
    • 2022-01-12
    190 min

    Pacopacomama 011222_591 Selected Mature 2021! 3 Hours DX, Part 1 Ai AoyamaChisato NishiyamaMikako TachibanaHitomi OkanoAi Yamamoto

  • amateur uncensoredpacopacomama



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored