hanasaki




FC2HZGDSHKDSTARSNACXHDKAKSBJBLKMVSDNATRGVHSQTEGMEMFSDSSATIDDASDONEZAVSASANNGODJUFE

2020-09-20
120 min

[MISM-183]True Nature Revealed S&M Super Hard Fuck Is Here! Non-Standard Slutty Masochist Girl Exposes Her True Desires! Sara Kagami

  • kagami sara censoredbeautiful girlbdsmMISMemumusume labMISM-183MISM183mism00183
    • 2020-10-01
    69 min

    [ZOZO-016]Shame! A Young Boys And Girls Mixed Naked Bodies Strength Test 2020 1 Warmup Exercises - Upper Body Stress Tests - Bending Forward Measurements/Vertical Jump Tests/Hula Hoop Tests

  • censoredZOZOsadistic villageZOZO-016ZOZO0161zozo00016
    • 2020-10-02
    41 min

    [CLO-083]Spasms! Pissing!! Trembling Fucks!!! Saryu Usui

  • sakisui censoredsquirtingblowjobCLOchobitchchovicCLO-083CLO083h-1435clo00083
    • 2020-10-10
    173 min

    [MIDE-833]Still Growing Up, and Barely Legal! Her Younger Sister Is A Teen With Little Sexual Knowledge, And I'm Secretly Fucking Her! Rokka Ono

  • rokka ono censoredblowjobbeautiful girlMIDEmoodyzusa pyonmoodyz divaMIDE-833MIDE833mide00833
    • 2020-10-13
    47 min

    FC2PPV 1532993 ☆ First shot ☆ Immediately delete the body! The fair-skinned slender beautiful girl of the I * ya clerk got the first Gonzo & the first vaginal cum shot ♪ [With benefits]

  • amateur uncensoredfc2
    • 2020-10-23
    483 min

    [DPEC-014]Neat And Clean Bitch Amateur Young Wife Sudden Change Creampie Sex SPECIAL!! 20 People, 8 Hours

  • censoredmarried womanamateurDPECdynamite enterprisedynamite platinumDPEC-014DPEC014h-1386dpec00014
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-10-30
    50 min

    Caribbeancom 103020-001 Won’t Let You Cum – Please Let Me Cum -Emi Aoi

  • emi aoi uncensoredhandjobbukkakecaribbeancom
    • 2020-11-20
    48 min

    [BTH-089]Beautiful Mature Bukkake Shizuka Kanno

  • kanna flower censoredsquirtingmature womanBTHchobitchchovicBTH-089BTH089h-1435bth00089
    • 2020-12-04
    58 min

    383REIW-018 Suzu

  • amateur censoredcreampieamateurreiwreiw-018reiw018383reiw-018
    • 2020-12-10
    55 min

    230OREC-651 Tanaka

  • amateur censoredcreampiebig titsorecorec-651orec651orec-651
    • 2020-12-25
    216 min

    [SKMJ-137]College Girl Amateurs Clean Filthy Cocks With Their Own Holes! With The Tip Lovingly Scrubbed By The Back Door This Huge Cock Is Shoved Into Her Dripping Pussy For The Rinse Cycle! Then All The Way To Her Womb For Some Hard Pounding Creampi

  • censoredcreampieamateurSKMJred face girlone topSKMJ-137SKMJ137h-1324skmj00137
    • 2021-01-09
    150 min

    [MIDE-870]My Stepdaughter (Mia) Seduced Me With Her Whispers... This Little Slut Rode Me Cowgirl Style... Mia Nanasawa

  • nanasawa mia censoredbeautiful girlslutMIDEmoodyzmametaro mamezawamoodyz divaMIDE-870MIDE870mide00870
    • 2021-01-16
    204 min

    [HUNTA-935]These Elder Sister Types Who Work At This Cafe Are Simply Erotic! I'm The Only Male Stuff Member And I'm Super Popular Here, So This Is The Absolute Greatest Workplace Ever!

  • censoredcreampieHUNTAhuntermorikihhh groupHUNTA-935HUNTA935hunta00935
    • 2021-01-22
    50 min

    FC2PPV 1655213 First shot ❤️ Enchanted erotic hips ☆ De М daughter is strangling and mass cum shot ☆ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-01-23
    52 min

    FC2PPV 1656863 [Personal shooting] First shot & first vaginal cum shot ★ Luna 20-year-old maid cafe clerk! I will do the first vaginal cum shot and Gonzo in my life.

  • amateur uncensoredfc2
    • 2021-01-29
    39 min

    [CLO-121]Shaking! Pissing! Trembling With Ecstasy! Orgasmic FUCKS! Kana Morisawa

  • kana morisawa kanako iioka censoredsquirtingblowjobCLOchobitchchovicCLO-121CLO121h-1435clo00121
    • 2021-02-09
    961 min

    [KTRA-278]Kate Live 20 Beautiful Girls Super BEST BOX Set Part 3 16 Hours, 4 Discs

  • jinguji temple nao kawahara maple censoredcreampiebig titsKTRAk tribeKTRA-278KTRA278h-094ktra00278
    • 2021-02-23
    29 min

    FC2PPV 1691265 Hostess Anna Hidden Camera Undisclosed Angle Mosaic Collapse Version ❤️ Many Benefits ❤️ First come, first served

  • amateur uncensoredfc2
    • 2021-03-01
    58 min

    324SRTD-0215 She volunteered for SEX with big breasts and the highest sensitivity of God’s milk sister!

  • amateur censoredbig titsamateursrtdsrtd-0215srtd0215324srtd-0215
    • 2021-03-01
    64 min

    492MERC-238 Innocent erotic curiosity

  • amateur censoredamateurmercmerc-238merc238492merc-238
    • 2021-03-04
    83 min

    [HONE-257]I Was Watching My Stepmom's Dripping Wet Nipples. Natsumi Omachi

  • natsumi omachi censoredcreampiemature womanHONEcenter villageminatoyahanazono center villageHONE-257HONE257h-086hone00257
    • 2021-03-06
    135 min

    [JUL-488]This Legendary Actress Is Starring In A Serious Drama, No.1 In An Exclusive Series!! When We Were Young, I Used To Play With Her, But Now That She's All Grown Up, I Realized, For The First Time, That She Was My Favorite "Madonna,&quo

  • kazama yumi censoredbig titsmature womanJULmadonnahiroyuki kimuraJUL-488JUL488jul00488
    • 2021-03-25
    75 min

    326KNTR-001 Cuckold NN Bulletin! Assault ww by a couple who came out of a love hotel Pregnancy juice explosion ww on a lewd body that is watched by a perverted boyfriend and goes crazy with another stick

  • amateur censoredcreampieamateurkntrkntr-001kntr001326kntr-001
    • 2021-03-27
    56 min

    H4610 ki210328 Manaka Hayashi 19years old

  • amateur uncensoredh4610
    • 2021-04-06
    90 min

    FC2PPV 1757093 Nice to meet you, Ladygra administration ♥ ️ Kime ☆ SEK class! An erotic girl who is too young hides her face and does not hide her pussy [Personal shooting]

  • amateur uncensoredfc2
    • 2021-04-07
    135 min

    512EMST-001 Thin Miku

  • amateur censoredcreampiebig titsemstemst-001emst001512emst-001
    • 2021-04-09
    119 min

    [MEYD-669]Cheating At Work - Horny Married Slut Hits On Her Coworkers Hat Her Part-Time Job For Daily Creampie Sex Sakura Misaki

  • cape sakura censoredcreampiesingle workMEYDtameike gororyo inugamiMEYD-669MEYD669meyd00669
    • 2021-04-18
    61 min

    413INST-114 [God Breasts OL / Orgy Individual Shooting] Kcup Miracle Big Breasts OL-chan and Orgy SEX with Tacopa with Ai ○! Heaven fucking where dicks are buried, swaying milk is a world erotic heritage! !! [Of course, raw vaginal cum shot]

  • amateur censoredcreampiebig titsinstinst-114inst114413inst-114
    • 2021-04-27
    65 min

    SIRO-4506 [First shot] [Soft body wide open leg cowgirl] [Temptation service] Marunouchi OL, a tall man who seems to be able to work. A nympho sister who voluntarily plays with a man’s nipple and has a provocative smile makes her big ass ripplin

  • amateur censoredamateursirosiro-4506siro4506siro-4506
    • 2021-04-27
    130 min

    [HOME-001]Sugar Baby In A One-Bedroom Apartment - Older Guy Nails His S********l Fuck Buddy For One Whole Day Of Creampie Sex

  • censoredcreampieschoolgirlHOMEfirst star100 raw styleHOME-001HOME001h-491home00001
    • 2021-05-18
    140 min

    [SDNM-283]Massage Parlor Slut - Her Smile Will Keep You Cumming Back For More - Age 33, Chapter 2 - She Makes Her Own Snacks For Her Customers - After A Little Liquor This Housewife Is Down To Get Wild

  • izumi freezing censoredblowjobmature womanSDNMsod createzaku araigenuine married woman the porn experienSDNM-283SDNM2831sdnm00283
    • 2021-06-11
    214 min

    [KRU-120]Voyeur Video Of An OL In A Pants Suit With A Big Ass

  • censoredKRUkarmamanji groupKRU-120KRU120kru00120
    • 2021-06-16
    80 min

    259LUXU-1423 Luxury TV 1418 A nursery teacher who smiles with a desire to like intense sex has appeared! When blamed for an unusually embarrassing appearance, he dyes his cheeks and is embarrassed, but gradually becomes open with a violent piston and

  • amateur censoredamateurluxuluxu-1423luxu1423259luxu-1423
    • 2021-07-01
    17 min

    FC2PPV 1898447 (Individual shooting) Thick blowjob while flickering the bra string! Minon-chan, a slender black-haired woman who looks like an adult and sucks erotically!

  • amateur uncensoredfc2
    • 2021-07-03
    242 min

    [VEC-483]My Mom's Friend: Highlights 4 - 4 Hours

  • censoredcreampiemature womanVECvenusmegami venusVEC-483VEC483vec00483
    • 2021-07-14
    116 min

    [ROYD-063]This Big Stepbrother Was Too Much In Love With His Little Stepsister, So He Became An In-House Stalker ... And Now He Can No Longer Control Himself! She Tried To Resist, But He Injected Her Bushy Bush With 13 Consecutive Demonic Rich And Cr

  • momose asuka censoredcreampiesisterROYDroyalkawajirihhh groupROYD-063ROYD063royd00063
    • 2021-07-28
    420 min

    GWARA-002 [Limited Time Sale] [Mgs Exclusive Distribution Best] Sex Talent Vol.02 Carefully Selected 20 People Carefully Selected Recording 7 Hours Special

  • amateur censoredamateurgwaragwara-002gwara002gwara-002
    • 2021-08-07
    63 min

    SIRO-4589 [First Shot] [Knowledged Neat Beauty] [Superb Blowjob Who Likes Service] A Beautiful Breasted Woman Who Is An Active Tutor Descends. Her Sexual Experience Is Thin, But Her Potential Is A Deep No-Hand Blow Job Exploding And Playing With A Co

  • amateur censoredamateursirosiro-4589siro4589siro-4589
    • 2021-08-14
    119 min

    [CMC-261]The Lineage Of A Stock of Beautiful Secretaries: The Sacrifices Of A Clique Of Secretaries Whose Small Waists And Hips Deserve Perfect Scores. Rena Asami.

  • asami rena censoredsingle workCMCcinemagickawamura shinichicollectCMC-261CMC261cmc00261
    • 2021-08-26
    129 min

    [HAVD-1011]Intense Kissing Live-in Lesbian Couple In Heat From Fucking All Night

  • takanashi arisa yuuri censoredlesbianHAVDhibinodr torihamaHAVD-1011HAVD10111havd01011
    • 2021-08-30
    52 min

    229SCUTE-1129 Rua (22) S-Cute Squirting Doesn’t Stop Squirting Cum Inside Sex

  • amateur censoredcreampiebig titsscutescute-1129scute1129229scute-1129
    • 2021-09-17
    54 min

    230OREC-886 Riho

  • amateur censoredcreampiebig titsorecorec-886orec886230orec-886
    • 2021-09-17
    150 min

    [MEYD-700]Tokyo"s No.1 Sex Service Info Site! Over 50,000 Followers On Social Media! Famous Social Media Influencer Makes Her AV Debut. Yuzu Sumeragi

  • emperor yuzu censoredbig titssquirtingMEYDtameike gorozack araiMEYD-700MEYD700meyd00700
    • 2021-09-25
    40 min

    FC2PPV 2246430 If You Rent A National Treasure-Class Fair-Skinned F Cup

  • amateur uncensoredfc2
    • 2021-10-23
    65 min

    H0930 tk0044 Manami Higaki 35years old

  • amateur uncensoredh0930
    • 2021-10-29
    139 min

    [MMND-202]"Excessive Filming" Nanami Ogura A 19-Year Old Innocent Babe With F-Cup Tits And A Voluptuous Body A Sakamichi-Style, Pure And Beautiful Girl

  • nanami ogura censoredbeautiful girlsingle workMMNDmimaniwasawa yukiMMND-202MMND202mmnd00202
    • 2021-10-30
    135 min

    [GVH-312]Big Tits Stepmom And Step-daughter Come To Tokyo For The WNTR Exam With A Big Dick Step-cousin That Fucks Them Both Like Crazy For 3 Whole Days. Mako Oda , Kokono Terada

  • oda mako terada here censoredbig titssisterGVHglory questtakahashi chitsujiGVH-312GVH312gvh00312
    • 2021-11-12
    65 min

    259LUXU-1497 Luxury TV 1482 The Carnal Desire Has Ignited Since The Last Appearance! ？？ The President’s Daughter Who Is Familiar With That Beautiful Big Tits Reappears! "I Want To Be Blamed Forcibly And Be Squid Many Times …" Dresse

  • amateur censoredbig titsamateurluxuluxu-1497luxu1497259luxu-1497
    • 2021-11-19
    65 min

    OREX-318 Sakura-san 2 (Tsuji Sakura)

  • amateur censoredcreampieamateurorexorex-318orex318orex-318
    • 2021-12-02
    140 min

    [ABW-175]もっと、汁 120 河合あすな 最大級の淫汁大噴出【MGSだけのおまけ映像付き 15分】

  • amateur censoredbig titssquirtingabwabw-175abw175abw-175
    • 2021-12-03
    166 min

    [HODV-21635]This Is The First Time I"ve Ever Seen A Celebrity Wife With A Huge Erect Penis In A Closed Room.

  • censoredcreampiebig titsHODVh m pHODV-21635HODV216355642hodv21635
    • 2021-12-24
    64 min

    SIRO-4749 [First Shot] [Marshmallow Huge Breasts] [Convulsions Acme] I Missed The Human Skin And Unearthed A Huge Breasts Beauty Whose Sexual Desire Does Not Subside Even If I Masturbate Every Day. While Shaking Her I Cup, She Grinds Her Hips Violent

  • amateur censoredbig titssquirtingsirosiro-4749siro4749siro-4749
    • 2021-12-27
    66 min

    481SACZ-103 Fumiko Miyake / Nagisa

  • amateur censoredmarried womanamateursaczsacz-103sacz103481sacz-103
    • 2021-12-31
    119 min

    [CAWD-323]Gazing, Whispering, Kiss-loving Girl"s Moist Kiss Seduction And Mucous Membrane Exchange Sex Natsu Hyuga

  • natsu hinata censoredcreampiebeautiful girlCAWDkawaiimichiru arashiyamaCAWD-323CAWD323cawd00323
    • 2022-01-01
    103 min

    [SQTE-397]Busty Goddess Honoka. J-cup Beautiful Woman With A Snake-like Tongue For Teasing. Honoka Tsujii

  • tsujii honoka censoredbig titsblowjobSQTEs cuteSQTE-397SQTE397sqte00397



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored