mochizuki




FC2JUFEKSBJAUKSMVSDABWBBANATIDSSISMILKPPPDSQTECESDSTARSDTTNATRWAAACHRVSANEBODONEZ

2020-10-09
240 min

[SOUD-009]You'll Get Unlimited Fucks With 20 Super Class Beauties At This Forbidden Secret Underground Sex Club! You'll Receive An Option For A POV Video Record Of Your Secret And Shameful Exploits That We're Going To Release To The Publi

  • censoredbeautiful girlSOUDprestigebest fuckingSOUD-009SOUD009118soud00009
    • 2020-10-16
    204 min

    [FCH-065][Distribution Only] "Heehee, You're So Hard!" Horny Gal Is Teasing Cock With Full POV!

  • star ameri sarina kurokawa censoredbeautiful girlslutFCHprestigefetish factionFCH-065FCH065118fch00065
    • 2020-10-24
    116 min

    [NNPJ-406]Picking Up Girls All Alone At Bars! This Sexy Exhibitionist Seemed Like A Good Girl At First, But Behind Closed Doors Turned Into A Total Slut Who Loves To Take It Raw! (23-Year-Old Preschool Teacher)

  • censoredcreampieblowjobNNPJnanpa japanno directorNNPJ-406NNPJ406nnpj00406
    • 2020-11-14
    129 min

    390JAC-068 [Anal 2 hole screaming x 7 vaginal cum shot] Mayumi, the crazy cum of the series! Mayumi Iku woman with a nipple or a kiss! Mayumi the woman who feels in a hole called a hole! Mayumi explodes with vaginal cum shot next to vaginal cum shot!

  • amateur censoredcreampiesquirtingjacjac-068jac068390jac-068
    • 2020-11-14
    95 min

    300MAAN-600 [Ultimate BODY x frenzy tide injection! !! ] Erotic golden ratio body of beautiful big breasts & nice ass & beautiful constriction! SEX is a Yar type until you get tired! Pole dance violently against Ji Po brought in erotic costum

  • amateur censoredcreampiebig titsmaanmaan-600maan600300maan-600
    • 2020-11-15
    44 min

    FC2PPV 1571364 * None * There is a dental hygienist part2 ⚠ The ban is lifted during life! ？？ ⚠ 2 shots in a row, 1 shot in the bath 1 shot in Chinacos ♡ Finally, a reward cleaning blow job ☆ There is a luxurious review privilege! !! !!

  • amateur uncensoredfc2
    • 2020-11-23
    66 min

    SIRO-4341 [First shot] [Goddess-class extreme body] [After immersive sex ..] The finest beauty who speaks the gentle Kansai dialect participates in the war. She exposed her beautiful face to the camera and turned on the switch at the end .. AV applic

  • amateur censoredamateursirosiro-4341siro4341siro-4341
    • 2020-11-26
    171 min

    [NHDTB-462]Beer Garden Perverts

  • censoredsquirtingNHDTBnatural highjanken kotamaNHDTB-462NHDTB4621nhdtb00462
    • 2020-11-30
    63 min

    SIRO-4326 [First shot] [Plump receptionist] [Sounds in the room ..] Yurakucho OL, who has given a calm answer, forgets himself for the unexpected pleasure of a big cock .. AV application on the net → AV experience shooting 1405

  • amateur censoredsquirtingamateursirosiro-4326siro4326siro-4326
    • 2020-12-11
    224 min

    [BAZX-261]Thick Sex With A Widow In Mourning Dress vol. 001

  • censoredcreampieamateurBAZXbazookatodoBAZX-261BAZX261h-1496bazx00261
    • 2020-12-18
    130 min

    [MKON-042]But I Liked Her First... The Girl Like Met A Player At Her Late-Night Job And The Next Morning Her Trash Bin Was Full Of Used Condoms Erina Oka

  • hill erina censoredcreampiebig titsMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-042MKON042mkon00042
    • 2020-12-25
    66 min

    FC2PPV 1619971 First shot ❤️ 173 cm badminton club! Rich SEX with a slender national music college student who has too few experienced people ☆ [Personal shooting]

  • amateur uncensoredfc2
    • 2020-12-27
    71 min

    476MLA-014 [Darkness of the entertainment world that attacks gravure] Rookie idols who allowed the body to decorate the cover ☆ Yoga goes crazy for the pleasure of Ji Po after a long time! !!

  • amateur censoredamateurmlamla-014mla014476mla-014
    • 2020-12-31
    167 min

    [BBAN-309]Total Oral Domination - Girl Boss Working From Home Keeps Her Favorite Pet Employee Satisfy Her Urges - The Days She Spent As A Lesbian Captive Sara Kagami Toko Namiki

  • kagami sara namiki touko censoredlesbiandeepthroatBBANbibianBBAN-309BBAN309bban00309
    • 2021-01-02

    FC2PPV 1629398 ≪First shot guarantee≫ Baby face receptionist (19) Actually erotic ☆ M bikini clothes play ❤ Wearing erotic individual shooting will increase sexual desire to the limit and explode w Sensitive big breasts erotic body Man hair man juice

  • amateur uncensoredfc2
    • 2021-01-12
    41 min

    FC2PPV 1633831 Limited quantity 2400pt → 1200pt [Yoga teacher] GoPro video full of immersive feeling ❤️ Beautiful big breasts that come out from the spobra ❤️ Love juice that stains pants even though you have not touched it ❤️ Purchase privilege avai

  • amateur uncensoredfc2
    • 2021-01-15
    47 min

    FC2PPV 1645865 [Personal shooting] Ginza club mom raises funds to protect the store Enko! Raw insertion cum shot in glamorous big ass

  • amateur uncensoredfc2
    • 2021-01-22
    74 min

    [orex-204]さとみさん

  • amateur censoredcreampieamateurorexorex-204orex204orex-204
    • 2021-01-29
    44 min

    [fan-097]あいる

  • amateur censoredbig titsamateurfanfan-097fan097fan-097
    • 2021-01-31
    131 min

    [MRSS-105]My Wife's Sister Has The Most Awful Husband, But These Days She Sure Seems To Be Spending A Lot Of Time At My Place Arisu Hanyu

  • arisa hanyu arisu hanyu censoredcreampiebig titsMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-105MRSS105mrss00105
    • 2021-02-13
    47 min

    FC2PPV 1650498 [Limited quantity 2980pt → 1980pt] 3P massage with a single person recruited on Twitter ❤️ Libido monster enchanted by the big dick of a single person ❤️ Intruding while jealousy Many 3P purchase benefits

  • amateur uncensoredfc2
    • 2021-02-19
    58 min

    SNYZ-019 Aria-chan

  • amateur censoredamateurcosplaysnyzsnyz-019snyz019snyz-019
    • 2021-02-22
    133 min

    [SRMC-029]It Can't Be True That You Can Make Sex Feel 100 Times Better Just Through The Power Of Suggestion! 2 Mizuki Yayoi

  • mizuki yayoi censoredsquirtingbeautiful girlSRMChypnosisrusher miyoshiSRMC-029SRMC029srmc00029
    • 2021-02-27
    33 min

    FC2PPV 1704769 A masterpiece K cup daughter Gonzo edition! After all the K cup was amazing w Wrapped in fluffy huge breasts and vaginal cum shot while dreaming ♥ * High quality version & review benefits included ♪ [Personal shooting / original]

  • amateur uncensoredfc2
    • 2021-03-02
    63 min

    FC2PPV 1700959 [Personal shooting] Yurie 36 years old Massive launch to a frustrated Irama-loving horny slender beautiful wife

  • amateur uncensoredfc2
    • 2021-03-03
    108 min

    [mgmr-132]HINA(26)

  • amateur censoredamateurbeautiful girlmgmrmgmr-132mgmr132mgmr-132
    • 2021-03-03
    198 min

    320MMGH-287 AV first appearance! Magic Mirror emergency business trip! “What kind of etch do you do？” Bamboo ● When I took off the mine make-up girl walking on the street, I wanted to see the horny snow-skinned F cup (and pink nipples) and

  • amateur censoredbig titsamateurmmghmmgh-287mmgh287320mmgh-287
    • 2021-03-04
    62 min

    [KBTV-065]Maybe If I'm Lucky The Fun And Outgoing Girl Who Likes To Flirt With Strangers Will Let Me Fuck Her？

  • censoredamateurblowjobKBTVmessy tvKBTV-065KBTV065h-1514kbtv00065
    • 2021-03-07
    136 min

    [TSF-015]You're A Male Office Worker, But When You Wake Up In The Morning, You've Discovered That You've Become A Woman (20) A Thorough Investigation You Were Bi And Absolutely The Dominant One, But Now You're Cumming Like A Bitch And

  • ao itaba censoredcreampiebeautiful girlTSFkaguyahimept mousouzokugynecomastia reportTSF-015TSF015tsf00015
    • 2021-03-18
    92 min

    [GREDB-1023]Love Scandal/Mizuki Ozawa

  • censoredbig titsbeautiful girlGREDBintec incGREDB-1023GREDB1023h-706gredb01023
    • 2021-04-02
    118 min

    [JUL-535]Hot Spring G*******g Blond Married Woman From The West Gets Fucked At A Coed Hot Spring Riri Heart

  • lily heart censoredmature womansingle workJULmadonnamametaro mamezawaJUL-535JUL535jul00535
    • 2021-04-09
    147 min

    [EBOD-816]Reverse Cheating! Ravished By Three Wild Busty Sluts At My Workplace (Nipples, Anal, Cock Teasing) Slut Harem.

  • aika hina nanami hina nanase censoredbig titsslutEBODe bodygoemonEBOD-816EBOD816ebod00816
    • 2021-04-13
    50 min

    HEYZO 2498 Deep Kiss, Furious Sex -Kiss Me A Lot!- – Amu Mashiro

  • amu mashiro uncensoredcreampiehandjobheyzo
    • 2021-04-15
    187 min

    [LZDQ-022]Yelling Out Together - Rei Tomeki, Ran Mukai

  • satoshi kuruki ai mukai censoredlesbianLZDQlesrenao masakirezure documentLZDQ-022LZDQ022lzdq00022
    • 2021-04-26
    49 min

    492JCHA-028 JK Fresh Erotic Oil Massa Treatment 7

  • amateur censoreduniformschoolgirljchajcha-028jcha028492jcha-028
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-08
    184 min

    [SQIS-050]Uniform Porn Braids / White Panties / Ribbons / Black Stockings

  • censoredschoolgirldramaSQISfa proSQIS-050SQIS050sqis00050
    • 2021-05-21
    84 min

    494SIKA-088 Bring Drunk Kyaba Miss To The Hotel And Spree Saddle

  • amateur censoredcreampieamateursikasika-088sika088494sika-088
    • 2021-05-22
    241 min

    [NASH-509]Eternal Madonna - Beautiful Cougar Super BEST 21 Women

  • hisae yabe yumi anno censoredbig titsmature womanNASHnadeshikoNASH-509NASH509nash00509
    • 2021-06-11
    45 min

    HEYZO 2563 Circle Of Sex-holic Pornstars -Jyun Mamiya- Vol.2 – Jyun Mamiya

  • jyun mamiya uncensoredheyzo
    • 2021-06-16
    280 min

    [DVDMS-676]Faces Revealed!! The Magic Mirror Number Bus These Office Ladies Work At First Class Corporations And Are Wearing Tight Suits And Showing Off Their Tight Asses Vol.02 Their Bulging Ass Were Wrapped In These Tight Business Suits And Once Th

  • censoredamateurDVDMSdeep sfunky hasegawathe magic mirrorDVDMS-676DVDMS676dvdms00676
    • 2021-06-26
    97 min

    [VENX-051]A Stepson Became A Practice Dummy For His Stepmom Who Decided To Work At A Soapland - Rio Ohara

  • osamu osamu censoredcreampiebig titsVENXvenuskaniefakecest winntersVENX-051VENX051venx00051
    • 2021-07-04
    54 min

    GERK-382 A-san

  • amateur censoredcreampiebig titsgerkgerk-382gerk382gerk-382
    • 2021-07-15
    112 min

    [DDOB-095]Brainwashing so that I Can Come in Her Pussy. Jun Haruaki.

  • jun shunmei censoredcreampiemature womanDDOBdogmatenunmy auntDDOB-095DDOB095ddob00095
    • 2021-07-30
    168 min

    [NKKD-222]These Couples Missed The Last Train So They Spend The Night Together! - They Just Happened To Be Going In The Same Direction, But They End Up Sharing More Than Just A Taxi! 12

  • censoredbig titsNKKDjet eizougroupNKKD-222NKKD222nkkd00222
    • 2021-08-18
    120 min

    [GVH-279]Stepmother And Offspring Sex, Haruka Aizawa

  • haruka serizawa kotone kuroki censoredcreampiemature womanGVHglory questkisakura kabinGVH-279GVH27913gvh00279
    • 2021-09-02
    54 min

    494SIKA-105 Miraculous Gully Small Tits Beautiful Girl Aheiki In The First 3p

  • amateur censoredschoolgirlamateursikasika-105sika105494sika-105
    • 2021-09-03
    149 min

    [CLUB-651]Sweaty Ex-gangster Housewife Has Filthy D***k-Fucking Trip With Her Younger Worker. Miss Nishimura, 36 Years Old.

  • censoredcreampiebig titsCLUBhentai shinshi kurabuCLUB-651CLUB651club00651
    • 2021-09-21
    70 min

    Pacopacomama 092121_535 Slut Teacher Who Is Too Dangerous Reika Ayano

  • amateur uncensoredpacopacomama
    • 2021-10-01
    217 min

    FC2PPV 2278247 Participating In The Sale! Special Price During The Sale Period! [No Individual Shooting, Fcup Beauty Witch, Affair Hot Spring Trip Second! ] I Love Each Other Until Just Before Divorce. I’m Working Hard To Make A Child All Day Lo

  • amateur uncensoredfc2
    • 2021-10-22
    100 min

    [YST-258]I Don"t Care If It"s The Right Thing To Do Or Not, I Want To Fuck Hirai-san Like Mad - Kanna Hirai

  • shiori hirai censoredcreampiedeepthroatYSTkoyachoYST-258YST258540yst00258
    • 2021-10-23
    241 min

    [SCOP-743]Legendary Hole In The Wall!! Crazy Service Investigation Highlights

  • censoredcreampieamateurSCOPscooptaro kSCOP-743SCOP743scop00743
    • 2021-11-05
    240 min

    [HUNBL-067]A Furious Iron-Hammer Face-Fucking for the Lesbian Sisters Who Hate Men

  • censoredcreampielesbianHUNBLhuntergeminihhh groupHUNBL-067HUNBL067hunbl00067
    • 2021-11-05
    122 min

    [JUL-773]マンションの上階に住むのは部長夫妻。決してバレてはイケないご近所付き合い…。上司の奥さんに搾精され続ける社宅生活。 北条麻妃

  • hojo asahi censoredmature womanslutJULmadonnakimura hiroyukiJUL-773JUL773jul00773
    • 2021-11-13
    63 min

    355OPCYN-200 Yu (Yu Shinoda)

  • amateur censoredbig titsamateuropcynopcyn-200opcyn200355opcyn-200
    • 2021-11-16
    65 min

    285ENDX-367 A Case Where A Fair-Skinned And Chikappa-Ish Beauty Member Made 3 Vaginal Cum Shot

  • amateur censoredcreampieamateurendxendx-367endx367285endx-367



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored