others




FC2KBIDASDBLKGMEMROYDSANAUKGIPXATIDAVSAAUKSNGODAUKGMEYDCAWDMILKSPRDMIDESSISMIDV

2020-11-06
478 min

[OFJE-283]Aika Yumeno 7 Years, 50 Titles

  • yumeno aika censoredbig titssquirtingOFJEs1 no 1 styleOFJE-283OFJE283ofje00283
    • 2020-11-19
    306 min

    [LZBS-065]Kissing Lesbian Sex So Hot And Heavy, They'll Be Melting In Each Other's Mouths With Sloppy French Kisses 5 Hours Of Super Selections An Ultra Deep And Rich Tongue-Twisting Drool-Exchanging Orgasmic Lesbian Series For Your Luxurious

  • june lovejoy oda mako censoredlesbianLZBSlesrebest lesbian playLZBS-065LZBS065lzbs00065
    • 2020-11-20
    55 min

    [oretd-800]KANNA

  • amateur censoredcreampieuniformoretdoretd-800oretd800oretd-800
    • 2020-11-22
    172 min

    [AKID-078]College Girls Only! I Took Her Back To My Room After A Party And Shot A Secret Video. I Was Quiet About This And Went To AV no.42: Slutty Huge Breasted Girls, Creampie Edition: Mami/Approximate G-cup, 21 Years Old (She Likes Older Men, So S

  • censoredcreampiebig titsAKIDomochikaeri mousozokumanji groupAKID-078AKID078akid00078
    • 2020-12-01
    120 min

    [C-2590]She Went On A Hot Spring Resort Vacation With A Male Acquaintance, And Her Husband Had No Idea (3)

  • censoredCgo goesgogo s coreC-2590C2590140c02590
    • 2020-12-04
    53 min

    FC2PPV 1594551 [Personal shooting] Cuckold training of a beautiful wife! Everyday to vaginal cum shot in the vagina of an obedient wife who follows selfish libido processing [appearance]

  • amateur uncensoredfc2
    • 2020-12-05
    119 min

    [SSNI-938]Ecstasy! First Experiences - Slim, Tall Girl Has Three Incredible Fucks - Multiple Orgasm Special Kanon Tsukishima

  • tsukishima kanon censoredbeautiful girlsingle workSSNIs1 no 1 stylezaku araiSSNI-938SSNI938ssni00938
    • 2020-12-18
    240 min

    [MBM-244]Luxury Eros Company Neat And Clean, Elegant Mature Woman Celebrity Babes We Seduced Them And Brought Them Home 12 Ladies 4-Hour Special 05

  • censoredamateurmature womanMBMprestigegaro sasazukambmMBM-244MBM244118mbm00244
    • 2020-12-20
    117 min

    [JUL-415]The Boss's Wife Is Turning Me On And I Don't Think She Knows It - Clothed Sex With Her Voluptuous Body - She's Even Sexier This Way Than Naked. Rin Okae

  • rin okae censoredcreampiebig titsJULmadonnarokusaburo mishimaJUL-415JUL415jul00415
    • 2020-12-27
    90 min

    [KTKC-103](A Private Video Session) 177cm x H-Cup Titties On The Strongest, Most Glamorous, Divine Body, And It Belongs To The Amateur, Megu-tan We Fucked Until The Break Of Dawn In This Video, And That's Why We're Calling It Private, And Now

  • censoredcreampiebig titsKTKCkitixx mousouzokubig titsKTKC-103KTKC103ktkc00103
    • 2021-01-01
    61 min

    Caribbeancom 010121-001 Caribbean Beauty Vol.32 Mai Amao

  • mai amao uncensoredanalcreampiecaribbeancom
    • 2021-01-01
    120 min

    [NACR-388]A Slender Art College S*****t With Beautiful Tits Her Stepfather Asked Her To Pose As A Nude Model, And Got So Excited That He Creampie Fucked Her. Rin Kira

  • kira ri censoredcreampieblowjobNACRplanet plusdirector oshichidomeNACR-388NACR388h-237nacr00388
    • 2021-01-06
    63 min

    SIRO-4383 [First shot] [Back side of serious girls] [Dirty milk x obscene ass] A job hunting junior high school student who looks serious. The super erotic gap SEX, which is contrary to the appearance, is a must-see. Climax many times while waving be

  • amateur censoredamateursirosiro-4383siro4383siro-4383
    • 2021-01-09
    176 min

    [MIAA-375]Master Masseuse Will Give Your Penis Pleasure Like You've Never Felt Before - Inside A Real Men's Massage Parlor In The City

  • tsujii honoka ayaka mochizuki censoredbig titsslutMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-375MIAA375miaa00375
    • 2021-01-15
    140 min

    [MMNT-007]A Real-Life Women's College 3rd Year S*****t With Overwhelming Lust Luna Hanazono Massive Squirting Sex, The Kind Where She Can Really Feel It

  • hanazono censoredbig titssquirtingMMNTk m producemillion mintMMNT-007MMNT00784mmnt00007
    • 2021-01-23
    156 min

    [CJOD-275]Ultra Sexy Dual Slut MILFs Beg For You To Cum Harder At Their Apartment-Turned-Brothel Yuri Honma Arisa Hanyu

  • really arisa hanyu arisu hanyu censoredcreampiebig titsCJODchijo heavenmametaro mamezawaCJOD-275CJOD275cjod00275
    • 2021-01-28
    114 min

    [FERA-125]Just The Tip - Not Quite Cheating With Your Stepmom Aiko Kuribayashi

  • aiko kuribayashi censoredcreampiemature womanFERAcenter villagedaichi minamirakuenFERA-125FERA125h-086fera00125
    • 2021-02-03
    85 min

    FC2PPV 1670065 [Appearance, uncensored, aptly elegant beautiful girl, if you like] In translation, screaming from the runaway beautiful girl’s waking up Squirting continuous demon squid w Conceived while screaming SEX! This is Gachiero.

  • amateur uncensoredfc2
    • 2021-02-17
    137 min

    [GVH-194]Trip With My Sexy Big-Titty Teacher! Exciting Three Day School Trip To The Hot Springs Yuria Yoshine

  • yoshine yuria censoredbig titsGVHglory questhyonGVH-194GVH19413gvh00194
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-21
    119 min

    [CAWD-187]First Aphrodisiac Sex: Convulsive Sex With A Bilingual J-cup Female Teacher - Miku Maina

  • maina miku censoredbig titssquirtingCAWDkawaiikyoseiCAWD-187CAWD187cawd00187
    • 2021-03-19
    95 min

    435MFC-090 [Extreme of a beautiful girl] Gonzo with an erotic bunny who is unrivaled in "cuteness" for 95 minutes! Cosplay and vaginal cum shot are OK, and it’s a love it angel incarnation rather than a rabbit! !! Is it the best to be sl

  • amateur censoredcreampieamateurmfcmfc-090mfc090435mfc-090
    • 2021-03-27
    149 min

    [DLPN-006]Training My Amateur Wife Like A Dog Naomi-san (30) Natural Masochist / Shameful Pissing / Slender / Shaved Pussy

  • censoredmarried womanamateurDLPNdolphin emmanuelDLPN-006DLPN006dlpn00006
    • 2021-04-01
    60 min

    488MCV-012 Life Insurance Lady Married Woman Likes SEX Too Much

  • amateur censoredamateurmcvmcv-012mcv012488mcv-012
    • 2021-04-08

    FC2PPV 1759707 Limited number [Uncensored] Creampie / cum shot after shopping with a busty apparel clerk

  • amateur uncensoredfc2
    • 2021-04-17
    60 min

    345SIMM-635 Creampie SEX As It Is Made By A Female Boss Who Seduces!

  • amateur censoredbig titsamateursimmsimm-635simm635345simm-635
    • 2021-04-18
    91 min

    300NTK-531 Indecent G Breasts Demon Kubire’s Finest Beautiful Wife Leaves Insertion In The Second Half Of The Gangbang! !! Two lewd married women x two other sticks, and the degree of ethics is 200 times! !! De Nasty Nature That Can’t Be Sh

  • amateur censoredcreampiebig titsntkntk-531ntk531300ntk-531
    • 2021-05-11
    30 min

    FC2PPV 1812134 [Infiltration Documentary] Roppongi Men’s Esthetics / Oil Handjob Hidden Shooting / Demon Nipple Attack Course [Kurashina Yo Aoi (24 years old) 2nd]

  • amateur uncensoredfc2
    • 2021-05-20
    184 min

    [SW-778]A Sweet And Sadistic Innocent Maid "I Love My Perverted Master's Cock" What A Piece Of Shit You Are! You Perverted Comic Lover! Marina Is A Sadistic Maid Who Is Spewing Vitriol At Me, And Kicking Me And Showing Off Her Panties And

  • marina saito censoredsingle workSWswitchlight fujimaswitch switchSW-778SW7781sw00778
    • 2021-05-20
    63 min

    [OKYH-070]Congratulations! The Ultimate S-Class Amateur! Nana, 20 - Estimated E-Cup - Won't You Try Entering The Men's Bath With Only A Small Towel？

  • censoredamateurOKYHsod createchain sectwhy do not you enter a men s bath with one towelOKYH-070OKYH0701okyh00070
    • 2021-05-21
    152 min

    [JUL-580]Flawless Big Booty Brides Madonna Exclusive Part 3! This Married Woman Joined Our Company Mid-Career And Her Beautiful Legs And Hot Ass In Pantyhose Have Lit My Lust On Fire... Risa Hoshizaki

  • lisa hoshisaki censoredmature womansingle workJULmadonnamametaro mamezawaJUL-580JUL580jul00580
    • 2021-06-11
    117 min

    [MIAA-450]A Pussy Rental For Upper Class Citizens Only A Big Tits Delivery Health Call Girl - My Former Classmate Was My First Love, But She'll Easily Have Creampie Sex With A Rich Boy Instead Of Me!! - Kanon Ibuki

  • kanobuki censoredcreampiebig titsMIAAmoodyzmametaro mamezawaeveryone s porn starMIAA-450MIAA450miaa00450
    • 2021-06-18
    125 min

    [HZGD-190]The Temptation Of Anal Sex With Her Husband's Employee: Wild Sex With The CEO's Busty Wife Riho Fujimori

  • riho fujimori censoredcreampiebig titsHZGDmarried woman garden theaterkinpika hanukemaruimage married woman garden theaterHZGD-190HZGD190h-1100hzgd00190
    • 2021-06-25
    239 min

    [YTR-155]Nothing But Bangin': Mitsuha Higuchi Gets Nailed For 4 Hours

  • mitsuha higuchi censoredcreampieYTRnonYTR-155YTR155h-127ytr00155
    • 2021-06-26
    39 min

    FC2PPV 1888701 [Personal shooting] Cuckold training for a beautiful wife covered in debt [Gonzo / Creampie]

  • amateur uncensoredfc2
    • 2021-06-28
    113 min

    300MIUM-726 Rookie OL of Spill F Cup and Summer Trip to Odawara! Spear-filled ● This is too hot ● This is a rare outbreak on the verge of burns! !! Plenty of sperm injection into the back of the vagina that is too hot! !! The vaginal cum shot that do

  • amateur censoredcreampiesquirtingmiummium-726mium726300mium-726
    • 2021-07-01
    78 min

    200GANA-2507 Seriously Nampa, first shot. 1656 Ask JD who picked up in Shibuya to shoot a slightly mature image video! I was dazzled by the rewards, and when I left myself to the flow … I was completely naked! Slender and small! I feel the cute

  • amateur censoredsquirtingamateurganagana-2507gana2507200gana-2507
    • 2021-07-02
    150 min

    [PRED-320]Being Desired By You Makes Me So Wet... Married Woman Becomes Obsessed With Adulterous Sex With A Younger Man Aika Yamagishi

  • aika yamagishi censoredcreampiesingle workPREDpremiumdragon nishikawaelegancePRED-320PRED320pred00320
    • 2021-07-08
    92 min

    [IENF-152]Sexual Feelings Of Sensitive Girls At An Oil Massage Parlor

  • hina hotaka takanashi arisa censoredcreampieIENFie nergyienfIENF-152IENF1521ienf00152
    • 2021-07-17
    149 min

    [HMN-022]Secretly Making Babies With My Girlfriend's Infatuated Sister, Starring Hana Himesaki

  • himesaki hana censoredcreampiebig titsHMNhon nakausa pyonHMN-022HMN022hmn00022
    • 2021-07-22
    142 min

    [HAWA-255]This Horny Housewife With A Big Ass Went And Spent The Night At A Cottage With A Cherry Boy College S*****t And Popped His Cherry Until The Break Of Dawn Riona-san

  • censoredbig titsHAWAcosmos eizomountain forestcosmospictures soft on demandHAWA-255HAWA2551hawa00255
    • 2021-07-24
    56 min

    FC2PPV 1939015 * Limited Time 2980⇒980pt ★ First Shot ☆ Youthful Petit Pichi Active Jd Akane-Chan 19 Years Old ☆ Bing On Ball Licking Blowjob ♥ Raw Squirrel With Glue ♥ Gun Thrusting And Finally Unauthorized Vaginal Cum Shot ♥ ※ There Is A Privilege

  • amateur uncensoredfc2
    • 2021-09-10
    120 min

    [SSIS-168]My MILF Stepmom Is Young And Pretty And So Kind, She"s The Apple Of My Eye, But I Just Stood There And Watched As These Vulgar Bad Boys Fucked Her Brains Out Miharu Usa

  • miharu hanasaki censoredbig titsblowjobSSISs1 no 1 stylerokusaburo mishimaSSIS-168SSIS168ssis00168
    • 2021-09-10
    157 min

    [BBAN-342]My Manager Is A Big Tits Nipple Teasing Lesbian. A Big Tits New Company Hire Who Climaxes From Her Manager"s Countless Intensive Nipple Teasing Nenne Ui Yuria Yoshine

  • first love yoshine yuria censoredbig titslesbianBBANbibianBBAN-342BBAN342bban00342
    • 2021-09-22
    50 min

    396BIG-113 Yuzu

  • amateur censoredcreampieschoolgirlbigbig-113big113396big-113
    • 2021-10-08
    149 min

    [SKMJ-219]*Barely Legal *Absolutely No Condoms *A 19-Year Old Bares Her Erotic Soul On A Hot Spring Resort Vacation *A 4-Fuck Fuck Fest *A Budding Model

  • censoredcreampieamateurSKMJsekimenjoshikantori wajimasekimen goshiSKMJ-219SKMJ219h-1324skmj00219
    • 2021-10-21
    239 min

    [DANDY-784]"How About A Mature Woman To Get Horny For？" Non-stop Fucking At The Campgrounds - Special. She Met A Younger Guy, Got Flashed And Saw His Hard Dick, Now This Older Lady Working As An Esthetician Wants To Tell All Her Co-workers De

  • censoredbig titsblowjobDANDYdandykikujiro ozuDANDY-784DANDY7841dandy00784
    • 2021-10-23
    119 min

    [NASH-584]"Let Me Make You Forget About Men" Spit And Love Juice Soaking Her Holes Down Below In This Reiwa Era Lesbian Hell.

  • censoredlesbianNASHnadeshikoNASH-584NASH584nash00584
    • 2021-11-12
    180 min

    [HJMO-479]These Beautiful Big Ass Married Woman Babes Are Playing The Guess Which One"s The Dildo Game A Big Dick Challenge! If She Guesses Correctly, She Wins 1 Million Yen! If She Gets It Wrong She Gets A Big Dick Quickie On The Spot! After Cum

  • censoredsquirtingHJMOhajime kikakujohann yuanHJMO-479HJMO479hjmo00479
    • 2021-11-27
    122 min

    [ITSR-098]Milf Gets Serious. "Stop The Teasing" She Says With A Laugh At First, But It Gets Real With A Signal To Full-on Sex! This Milf Gets A Serious Creampie At The End!？ - 8. Misato-san (48), Shitara-san (49)

  • censoredcreampieamateurITSRbigmorkalmaxchou itadakiITSR-098ITSR09857itsr00098
    • 2021-12-02
    103 min

    [IQQQ-028]A Married Female Teacher Who Gets 10 Times Wetter Climaxing During Her Class, When She Can"t Make A Sound Reiko Kobayakawa

  • kobayakawa reiko censoredcreampiemarried womanIQQQcenter villagesouthern earthzora center villageIQQQ-028IQQQ028h-086iqqq00028
    • 2021-12-03
    129 min

    [SHKD-980]The Man I Hate Who Ravaged Me. I"ll Never Forget How He Moved His Hips...Kana Sasaki

  • natsuna sasaki censoredsingle workdramaSHKDattackerstakuo ohtanishi yoru akuSHKD-980SHKD980shkd00980
    • 2021-12-16
    138 min

    [AKDL-156]Intense Ejaculations! She Won"t Be Satisfied With Only One! I Was Drained Dry By Her Wild Blowjobs And Handjobs

  • takashiki wakamiya censoredbig titsbeautiful girlAKDLakinoriaknrAKDL-156AKDL1561akdl00156
    • 2021-12-17
    154 min

    [MIDV-019]My Girlfriend"s Older Sister Has An Excessive Sex Drive, And Is Pressuring Me With Her Hot And Horny Big Ass! She"s Continuously Pounding Me With Demonic Thrusts As This Slut Hits Me With Out-Of-Control, Piston-Pounding Glory! Nozom

  • ishihara hope censoredcreampieslutMIDVmoodyzhirokoji osakimoodyz divaMIDV-019MIDV019midv00019
    • 2021-12-17
    154 min

    [JUFE-355]Brown Lascivious But Dominant Slut Uses Dirty Talk To Control Ejaculation. POV JOI Kaho Imai

  • natsuho imai censoredbig titsslutJUFEfitchaida yumenoJUFE-355JUFE355jufe00355
    • 2021-12-24
    42 min

    SKHO-025 Sumire (Sumire Kuramoto)

  • amateur censoredcreampieschoolgirlskhoskho-025skho025skho-025



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored