shi




FC2MEYDMARALULUKSBJNNPJSDABGMEMWAAAPREDVEMAMIAADASDADNSHKDAUKGHDKASQTEAUKSMIDEBLK

2020-11-23
138 min

[APAK-187]Naughty Intern - All Alone With My Supervisor？! One Night, Two Days Of Taking His Huge Cock And I Still Can't Get Enough Mitsuha Higuchi

  • mitsuha higuchi censoredcreampieblowjobAPAKaurora project annexrkaurora project anexAPAK-187APAK187apak00187
    • 2020-11-26
    45 min

    FC2PPV 1584358 Limited discount for the first 20 bottles [5000 → 1980] 175cm de М Former model Sex slave screaming sex & privilege 3P with unknown number of deaths

  • amateur uncensoredfc2
    • 2020-11-26
    111 min

    [FSDSS-127]She Normally Likes Them Super Young, And It's Been A While Since This Babe's Been Fucked By A Grown Man Arina Hashimoto

  • there is hashimoto censoredsingle workFSDSSfalenoponyfaleno starFSDSS-127FSDSS1271fsdss00127
    • 2020-12-03
    75 min

    [AKDL-068](Offline Meetup Fuck Fest Videos) Is This Girl With Idol-Good Looks Not Only Cute But Also A Prematurely Ejaculating Slut!？ When She Likes To Get Down, This Bitch Cosplayer Gets Into The Mood Nozomi Nozomi Arimura

  • arimura nozomi censoredAKDLaquinoristickaknrAKDL-068AKDL0681akdl00068
    • 2020-12-05
    119 min

    [ATID-445]If You Can Help Me I'll Give You My Anal Hole, Teacher... Riho Yuki

  • riho yuki censoredanalsingle workATIDattackerseitaro hagaein madATID-445ATID445atid00445
    • 2020-12-15
    245 min

    [NPS-406]Real Pickup! Will You Punch My V-Card, Please？ They Forget The Camera's Running At The Chance For Creampie Sex With A Hot Male Virgin - 81 Orgasms! 15 Loads!

  • censoredcreampiesquirtingNPSpetersken kikuchinampaNPS-406NPS406h-021nps00406
    • 2021-01-01
    120 min

    [KCDA-294]108cm K-Cup Titties Marina Yuzuki

  • marina yuzuki censoredbig titsslutKCDAdigital arkdigital ark digital arkKCDA-294KCDA294kcda00294
    • 2021-01-13
    66 min

    FC2PPV 1643493 042 [Cum & Facial Cumshot] Let a daughter with a sickness drink a large amount of the juice and finally get completely dirty with 10 doppyu facial cumshots

  • amateur uncensoredfc2
    • 2021-01-22
    31 min

    [BTH-111]Feel My Squirting Seed Juria Tachibana

  • tachibana risa censoredblowjobbukkakeBTHchobitchchovicBTH-111BTH111h-1435bth00111
    • 2021-01-29
    42 min

    490FAN-080 Hitomi

  • amateur censoredamateurfanfan-080fan080490fan-080
    • 2021-02-05
    33 min

    [BTH-114]If You Do It On My Face, My Husband Will Find Out... At Least, Please Cum In My Mouth Instead Anri Sugisaki

  • anri sugisaki censoredmarried womanbukkakeBTHchobitchchovicBTH-114BTH114h-1435bth00114
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-16
    65 min

    SIRO-4423 [First shot] [De M thirty woman] [Screaming screaming ..] Sensitive lady who is shy about handsome guys drowns in pleasure. Was sex after a long time more pleasant than I imagined .. Application amateur, first AV shooting 193

  • amateur censoredamateursirosiro-4423siro4423siro-4423
    • 2021-03-13
    118 min

    [MUDR-142]I Committed A Sin A Beautiful Y********l In Uniform The Purge Of A Chastised Bitch Mahiro Ichiki

  • mahiro ichiki censoredcreampiebdsmMUDRmukuMUDR-142MUDR142mudr00142
    • 2021-03-16
    60 min

    SIRO-4405 [First shot] [Fluffy natural boobs] [Boxed daughter’s treatment] A 20-year-old naive girl who attends a women’s college. Raised in a strict family, she shouts her pleasure with her moist eyes .. Application amateur, first AV shoot

  • amateur censoredbig titsamateursirosiro-4405siro4405siro-4405
    • 2021-03-18
    184 min

    [PPPD-915]"For Everyone Who Wants To Cum While Smothered In Tits!" Squished Between Dual Pairs Of Great Boobs In A Creampie Massage Parlor Three-Some

  • haruna hana maki kyoko censoredcreampiebig titsPPPDoppaiPPPD-915PPPD915pppd00915
    • 2021-03-20
    100 min

    FC2PPV 1733702 A beautiful teacher in the infirmary of an elementary school in the first year of working life. Although she is an intelligent lady who graduated from a prestigious university, she is in danger of her life collapsing after being Gonzo.

  • amateur uncensoredfc2
    • 2021-03-29
    63 min

    328HMDN-349 [♀ Personal Shooting] Natsuha-chan 23-year-old model-class beauty OL ☆ Cock-hungry advertising agency’s carnivorous Bali carry OL’s peach butt is pierced in the vagina with wild copulation SEX and squirrels die SEX [Amateur vide

  • amateur censoredamateurhmdnhmdn-349hmdn349328hmdn-349
    • 2021-04-10
    130 min

    [DVAJ-508]"Sometimes I Want To Be A Filthy Girl" By Nanami Kawakami "Isn't It Just Drama These Days？ Sometimes, I Just Want To Fuck As Many Boys As I Like..." She Said, So I Got A Whole Bunch Of Masochistic Guys Together, And Got

  • kawakami nanami censoredslutsingle workDVAJalice japansamoariDVAJ-508DVAJ508dvaj00508
    • 2021-04-11
    30 min

    FC2PPV 1764394 [3P Orgy] [Snow Skin / Snow Breasts] 20-year-old JD who both parents lost their jobs and had to expose their beautiful skin to earn school fees. In her first orgy in her life, she holds two cocks in her upper and lower mouths

  • amateur uncensoredfc2
    • 2021-04-15
    240 min

    [GIGL-644]Hidden Camera Voyeur Footage At A Bar - MILF Alone At A Pub Brought Home By A Man Gets Fucked Beyond His Wildest Dreams!

  • censoredmarried womanamateurGIGLgigolojun nagasawaGIGL-644GIGL644gigl00644
    • 2021-04-17
    162 min

    [CAWD-207]Girls Who Fuck With All Their Might - Young, Beautiful Girl Set To Be Married Soon With Fair Skin. Mai Kagari From Aomori, Age 20

  • flower hunting censoredsquirtingbeautiful girlCAWDkawaiihiroyuki kimuraCAWD-207CAWD207cawd00207
    • 2021-04-24
    118 min

    [HOKS-095]The Life Of A Middle Aged Couple Who Get Along With Each Other

  • yuka hirose kyoko kubo censoredmature womandramaHOKSfa prokinzo ogurokkuHOKS-095HOKS095hoks00095
    • 2021-04-30
    97 min

    380SQB-099 Saya

  • amateur censoredamateursqbsqb-099sqb099380sqb-099
    • 2021-05-15
    105 min

    300NTK-565 Celebration! !! Newcomer! !! The style is too good and the whitening boyne beauty is full of ethics. !! I want to be buried in the lust of Echikos Bunny, a beautiful gorgeous bubbly! !! De Nasty Ma ○ Ko who accelerates the chain with a fri

  • amateur censoredcreampieamateurntkntk-565ntk565300ntk-565
    • 2021-05-27
    131 min

    [JRZE-052]First Time Filming My Affair - Mayuko Wakana

  • mayuko wakana censoredcreampiemature womanJRZEcenter villageminatoyajurakuJRZE-052JRZE052h-086jrze00052
    • 2021-06-06
    76 min

    476MLA-022 [Back Customs x F Breasts x Skillful Day Trader] A super gap of the ultimate beautiful BODY with a baby face! Juicy de nasty Ma ○ Ko gets sick! Inevitable erection is the reverse piss that shakes the hips with Erokos SEX! !! 4 barrage to s

  • amateur censoredcreampiebig titsmlamla-022mla022476mla-022
    • 2021-06-24
    172 min

    [NHDTB-542]I Rubbed Aphrodisiacs On My Stepsister's Nipples Every Night Until They Became So Sensitive That Just Touching Them Made Her Cum

  • censoredbig titssisterNHDTBnatural highremonha to nakashimaNHDTB-542NHDTB5421nhdtb00542
    • 2021-07-02
    59 min

    300NTK-597 [Creampie Angel Squirting Sprinkler Kimeseku! !! ] God created Gachi angel visual face & Echiechi body! !! Even though it’s small … Libido is the universe! !! In addition, the aphrodisiac brought by liberation makes it horny!

  • amateur censoredcreampiesquirtingntkntk-597ntk597300ntk-597
    • 2021-07-20
    109 min

    [OFKU-185]My Bride's Mother, Who Came To Tokyo From Kochi...My Colossally Busty Mother-In-Law From Tosa: Natsuki Fujioka, 51 Years Old

  • natsuki fujioka censoredcreampiemature womanOFKUstar paradisemom railOFKU-185OFKU185h-254ofku00185
    • 2021-07-31
    151 min

    [KTB-049]The Fresh OL Club! Ichika Ichika Matsumoto

  • ichika matsumoto censoredschoolgirlsingle workKTBkahanshin tigers mousozokukahanshin tigersKTB-049KTB049ktb00049
    • 2021-08-01
    247 min

    [ZMAR-046]All! Airi Natsume

  • natsume atago censoredcreampiesquirtingZMARplanet plusmaruttoZMAR-046ZMAR046h-237zmar00046
    • 2021-08-10
    133 min

    [HSM-031]Trap Graduation. Hime.love Yume Kobayashi -Crossdresser"s Last Fuck Is A Creampie-

  • censoredamateurHSMhime styleHSM-031HSM03159hsm00031
    • 2021-08-17
    65 min

    10musume 081721_01 Meet the Short Hair Amateur Girl Who Loves to Have Sex Hibiki Sakurano

  • amateur uncensored10musume
    • 2021-08-17
    211 min

    [STARS-394]The No.1 Neat And Clean Gravure Idol An Idol Dreams Of Having Sex In The Image Video Age Kanan Amamiya (Overwhelming 4K Video Nookie!)

  • hanan amamiya censoredbig titsSTARSsod createSTARS-394STARS394
    • 2021-08-29
    49 min

    292MY-459 Sho Miyoshi 1

  • amateur censoredmarried womanamateurmymy-459my459292my-459
    • 2021-09-04
    34 min

    [495MOJ-012]【玩具で快楽UP】素人生ハメSEX

  • amateur censoredamateurbukkakemojmoj-012moj012495moj-012
    • 2021-10-01
    238 min

    [KWBD-306]BEST Handjob Collection. Co-Masturbation With Cute, Sexy Girls! 47 Cumshots As They Look On Entranced!

  • maiyuki ito sakura moko censoredblowjobbeautiful girlKWBDkawaiiKWBD-306KWBD306kwbd00306
    • 2021-10-01
    119 min

    [NNPJ-476]Real On-The-Street Interview In Kabukicho. We Found Broke, Runaway Girl Koharu In the To-Yoko Neighborhood, Then Took Her Back To Our Place To Use As A Fucktoy

  • censoredcreampieblowjobNNPJnampa japanNNPJ-476NNPJ476nnpj00476
    • 2021-10-02
    140 min

    [PKPD-164]H Cup Chubby Cosmetologist Fuck Buddy Misono Is Healing And So Cute, Misono Mizuhara

  • suwon miso censoredcreampiebig titsPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-164PKPD164pkpd00164
    • 2021-10-10
    244 min

    [ERHT-005]Hot POV Voyeur Porn Is The Best 5

  • censoredmarried womanERHTariseflea market ariseERHT-005ERHT005h-1577erht00005
    • 2021-10-15
    204 min

    [MIDE-987]Nothing Better Than Tits To Get Horny To! Super Tight Titty Fuck Action To Drain Those Balls For Huge Cum Loads Over And Over! Huge Tits Massage Parlor That Excels In Making Guys Cum. Fumika Nakayama

  • nakayama fumika censoredbig titsslutMIDEmoodyzgoemonmoodyz divaMIDE-987MIDE987mide00987
    • 2021-10-20
    67 min

    230OREC-909 Sayaka (Sakura Tsuji)

  • amateur censoredcreampiebig titsorecorec-909orec909230orec-909
    • 2021-10-26
    63 min

    [SIRO-4678]【初撮り】【惚れ惚れするクビレ】【濃厚バキュームフェラ】透き通るような白肌美乳

  • amateur censoredamateursirosiro-4678siro4678siro-4678
    • 2021-10-30
    36 min

    FC2PPV 2389932 Is This A Lie？ [Overwhelming Beautiful Girl Who Is Already Active As An Idol Appears] Massive Oral Ejaculation With A Blowjob In The Car In The Daytime

  • amateur uncensoredfc2
    • 2021-11-03
    95 min

    546EROF-005 [First Outflow / Media Appearance] Pastry Chef Apprentice On The Way Back From France Abdominal Muscle Slender Beauty Shot With Aphrodisiac Seriously A Muscle Spasm Acme With A Quick Drink! Record Of Vaginal Cum Shot In A Tight Pussy

  • amateur censoredcreampieamateureroferof-005erof005546erof-005
    • 2021-11-21
    63 min

    413INST-185 [Leaked] Big Breasts I Cup Gravure Idol Individual Photo Session Hotel Video Leaked Gonzo Creampie With Secret Individual Shooting From Idol (Yukino Nagisa)

  • amateur censoredbig titsamateurinstinst-185inst185413inst-185
    • 2021-11-25
    180 min

    [SDAB-204]生徒会長はくびれ巨乳 久里くらら SOD専属AVデビュー

  • kuri kurara censoredbig titsSDABsod createmasaki naoseishun jidaiSDAB-204SDAB204
    • 2021-11-30
    59 min

    [HEYZO-2665]Yume Yokoyama Tiny Tits Girl Gets Fucked

  • yume yokoyama uncensoredcreampieheyzo
    • 2021-12-03
    141 min

    [HEYZO-2688]tong jenny waan Sex in Asia ＃Tong ＃Jenny ＃Waan

  • amateur uncensoredheyzo
    • 2021-12-08
    55 min

    FC2PPV 2499630 [First Shot] Karate’s Inter-High School Championships No. 1 In Japan ☆ Beautiful + Muscular Wife Is Squirting And Vaginal Cum Shot ☆ "I’m Doing Martial Arts As A Hobby Now. I’m A Bold Woman, So The Number Of Experien

  • amateur uncensoredfc2
    • 2021-12-12
    60 min

    230OREC-966 Dr. Aihara (Tsukiha Aihara)

  • amateur censoredcreampiebig titsorecorec-966orec966230orec-966
    • 2021-12-16
    82 min

    [REBD-612]Mami: Daylight Twilight * Mami Sakurai

  • mami sakurai censoredsingle workREBDrebeccachikara sawamuraREBD-612REBD612h-346rebd00612
    • 2021-12-17
    76 min

    [HEYZO-2690]Ena Requesting The POV Fuck Option -Yokohama-

  • ena uncensoredheyzo
    • 2022-01-01
    123 min

    [BIJN-213]The Documentary Wild Animalistic Sex The Awakening Of A Gorgeous Businesswoman With An Amazing Body ~ Climax ~ Orgasm ~ Ascendance! Natsuki Kisaragi

  • natsuki kisaragi censoredbig titssingle workBIJNbijin majo emmanuelleBIJN-213BIJN213bijn00213
    • 2022-01-14
    170 min

    [JUFE-363]Cum Dumpster With Huge I-Cup Tits Teaching Assistant Is G*******ged By The Teacher And S*****ts Monami Takarada

  • takarada monami censoredcreampiebig titsJUFEfitchJUFE-363JUFE363jufe00363



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored