with horikita




FC2JULPREDSQTEMVSDSPRDDASDMARACAWDIPXHZGDCESDMIAAMIDEFSDSSAVSAVENUSDABNGODVEMAHUNTB

2020-10-30
45 min

[DHT-209]Amateur Housewife With Issues: Beautiful Married Woman Picked Up Through Dating App: Ran, 26

  • censoredcreampiebig titsDHThot entertainmentmohri smithDHT-209DHT20959dht00209
    • 2020-10-30
    76 min

    [OTIM-043][Distribution Only] [Daydream POV] Ikebukuro Co-S******g Most-Requested Reflexologist - Serious Hottie! All-You-Can-Fuck Business Trip Rental Girl Mitsuha Higuchi

  • mitsuha higuchi censoredcreampieuniformOTIMprestigeonetimeOTIM-043OTIM043118otim00043
    • 2020-11-01
    121 min

    [SCR-255]Big Tits And Tempting Uniform Intercourse: Trendy S********ls' Lewd Record

  • censoredcreampiebig titsSCRglay zs crimeSCR-255SCR25512scr00255
    • 2020-11-07
    30 min

    FC2PPV 1561332 Limited to a few days [Individual] The wife of a new customer is taken to an inn and vaginal cum shot by two strangers

  • amateur uncensoredfc2
    • 2020-11-12
    478 min

    [KNAM-029]Complete Raw [email protected] #oneyearanniversary #total30people480min #rawrecord #massivecreampie #specialthankyouprice!

  • censoredcreampiebig titsKNAMfirst starcomplete raw styleKNAM-029KNAM029h-491knam00029
    • 2020-11-19
    121 min

    [OKSN-308]New Wives With Godly Tits: A Cherry Boy Finds Himself In The Crosshairs Of His Dad's New Wife, Who Is A Totally Wild Slut, And Is Excited By The Potential In Her New Son-In-Law's Cock

  • censoredbig titsslutOKSNabc mousouzokuokasan.comOKSN-308OKSN308oksn00308
    • 2020-11-29
    128 min

    [KTKL-090]A Lolita Dick-Sucking Little Devil Slut Hinako "I Get Excited When I Put Men In Embarrassing Situations"

  • censoredcreampieslutKTKLkitixx mousouzokuloliconKTKL-090KTKL090ktkl00090
    • 2020-12-22
    61 min

    Caribbeancom 122220-001 Jeans Beauty Vol.29 Non Suzumiya

  • non suzumiya uncensoredcreampiecaribbeancom
    • 2020-12-26
    120 min

    [JBJB-018]帽子が似合う癒し系美白ギャル おじさんチ●ポを弄んだりバコ突きされたりでハツラツ笑顔からのヤバアヘ顔！ 鈴木真夕

  • suzuki mayu censoredJBJBsharkjabujab townJBJB-018JBJB018h-687jbjb00018
    • 2021-01-16
    119 min

    [SSNI-971]Forbidden To Masturbate For One Whole Month, She's Transformed Into A Raging Horny Slut! Extreme Squirting Nympho FUCK Hiyori Yoshioka

  • hiyori yoshioka censoredsquirtingbeautiful girlSSNIs1 no 1 stylemon cSSNI-971SSNI971ssni00971
    • 2021-01-24
    55 min

    285ENDX-322 A 20-year-old female college student who runs out of vaginal cum shot twice! I’m 100 times wetter than usual at the woman on top posture that I can insert from myself!

  • amateur censoredcreampieamateurendxendx-322endx322285endx-322
    • 2021-01-28
    20 min

    Caribbeancom 012821-001 Pussy Encyclopedia : Miyu Morita

  • miyu morita uncensoredcaribbeancom
    • 2021-02-06
    159 min

    [SSNI-982]The Tall, Slender Athlete With Beautiful Legs That Everybody's Talking About... Falls Prey To Competitive Swimming Fans Who Want To Enjoy Her Lithe Body Marin Hinata

  • marin hinata censoredsingle workSSNIs1 no 1 stylebungo maedaSSNI-982SSNI982ssni00982
    • 2021-02-17
    81 min

    FC2PPV 1689768 [Personal shooting / set sale] Wife who struggles between pride and pleasure Complete version

  • amateur uncensoredfc2
    • 2021-02-18
    22 min

    [ZOZO-054]A Prologue To Shame! Mondays Are All-Nude Days Akane Shiki

  • censoredcreampiebig titsZOZOsadie willenauZOZO-054ZOZO0541zozo00054
    • 2021-02-20
    55 min

    Caribbeancom 022021-001 Soapland With Young Girl Only, 10 Minori Koike

  • minori koike uncensoredcreampiehandjobcaribbeancom
    • 2021-02-25
    123 min

    [FSDSS-174]Saliva~ (Heart) Beautiful Y********l in Uniform`s Wet Kissing Fuck - Ena Satsuki

  • ena satsuki censoredbig titsschoolgirlFSDSSfalenoflagmanfaleno starFSDSS-174FSDSS1741fsdss00174
    • 2021-03-06
    160 min

    [DVDMS-641]A Normal Boys And Girls Focus Group Adult Video We Followed These Team Members Who Had Consecutive Creampie Sex In The Bathhouse During Training Camp, And Checked Up On Them Afterward Too In This Special Everyone's Favorite Big Tits Fe

  • censoredcreampiebig titsDVDMSdeep syosukeDVDMS-641DVDMS641dvdms00641
    • 2021-03-06
    53 min

    H0930 ki210306 Requested work

  • amateur uncensoredh0930
    • 2021-03-06
    75 min

    FC2PPV 1713796 [Personal shooting] S-class sober glasses girls advent !! It looks like a sober and non-motivated girl, and if you take it off, you will have a big tits throat body !! Seeding * Main story appearance

  • amateur uncensoredfc2
    • 2021-03-12
    109 min

    483SGK-017 [Different Dimension I Eye Cup] [Spring Pie Festival] [Big Breasts Instructor Beyond Big Breasts] [4 Barrage Raw Saddle] [Continuous Pursuit Creampie] [Libido Explosion Iki Madness] ABCDEFGH … I Cup! !! Phantom eyecup! I think I can&#

  • amateur censoredsquirtingamateursgksgk-017sgk017483sgk-017
    • 2021-03-21
    119 min

    [JUL-513]Raw Sex With A Married Maid Who Will Do Whatever You Want

  • karen sasahara censoredcreampiemature womanJULmadonnarokusaburo mishimaJUL-513JUL513jul00513
    • 2021-03-27
    120 min

    [KSBJ-128]My Step Mom Loves Playing WIth Me Matsuri Kanan

  • nichinan festival censoredcreampieblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-128KSBJ128ksbj00128
    • 2021-03-28
    58 min

    H0930 tk0031 Kanna Noi 34years old

  • amateur uncensoredh0930
    • 2021-04-02
    157 min

    [HUNTA-978]I Was The One And Only Boy At My Rural School Of Five S*****ts! There's Nothing To Do Out Here - Except Bang! Nobody Cares Which Grade They're In, It's An Orgy!

  • censoredcreampieschoolgirlHUNTAhunterkawajirihhh groupHUNTA-978HUNTA978hunta00978
    • 2021-04-05
    66 min

    SIRO-4473 [First shot] [Swaying married woman’s soft milk] [Wife is dirty] Frustrated wife who has been married for 10 years is crazy about sex with other than her husband. She disturbs her big tits and greets her climax, she rides on a man .. A

  • amateur censoredbig titsmarried womansirosiro-4473siro4473siro-4473
    • 2021-04-15
    240 min

    [OKAX-725]Sex Stories Of Step Grandsons Getting Hard From Looking At Their Step Grandmother's Surprisingly Sexy Bodies 4 Hours

  • censoredbig titsamateurOKAXkm producedick poisonside dishesOKAX-725OKAX725okax00725
    • 2021-04-17
    146 min

    [CAWD-208]"I'm So Bored, I Need Some Stimulation!" Alluring College Girl With A Big Booty - Miona Kotoha - She Speaks Japanese, English, And Korean - Now This Stunning, Globe-Trotting Hottie Is Back In Japan And Ready For Her Porn Debut M

  • miona hori censoreddeepthroatsingle workCAWDkawaiimichiru arashiyamaCAWD-208CAWD208cawd00208
    • 2021-05-05

    FC2PPV 1767822 [Personal shooting] Ai 20 years old Blow & Handjob Remastered version [Limited time offer]

  • amateur uncensoredfc2
    • 2021-05-07
    120 min

    [FSDSS-216]Erotic Voice And Sweat: Extreme Dirty Talk Beauty Salon - Sora Amakawa

  • tenkawa sora censoredbig titssingle workFSDSSfalenozampafaleno starFSDSS-216FSDSS2161fsdss00216
    • 2021-05-07
    204 min

    [HAWA-247]A Cuckold Investigation "It Was Supposed To Be An Anniversary Filming Of A Married Couple Having Sex, But Instead It Turned Into A Surrogate Fuck Fest..." When This Horny Wife Keeps Getting Her Pussy Plugged By Another Man's Coc

  • censoredbig titsHAWAcosmos eizomountain forestcosmospictures soft on demandHAWA-247HAWA2471hawa00247
    • 2021-05-17
    40 min

    318LADY-370 Shizuku

  • amateur censoredamateurladylady-370lady370318lady-370
    • 2021-06-25
    48 min

    HEYZO 2565 POV Fuck Option With Rookie Call Girl Plus Creampie For Free – Miss Deli Yuka

  • derijyouyuka uncensoredheyzo
    • 2021-06-26
    93 min

    300MAAN-668 [Two Idol Class CAs Brush Down Together] Netri Jupo Blow Shows The Professional Soul Of Hospitality In Front Of A Boyfriend & Waist Swing Cowgirl And Virgin Immediately Cum Inside 3P! Reconciliation SEX with a boyfriend is a rainy day

  • amateur censoredcreampieamateurmaanmaan-668maan668300maan-668
    • 2021-07-06
    142 min

    [SDNM-294]This Beautiful Caregiver Is Cheerful And Energetic And Spends Every Day Taking Care Of The Elderly Miyu Kurita 28 Years Old The Final Chapter Exhibitionist / Tied Up / Golden Shower Action ... She's Away On A Vacation, Far Away From Her

  • miyu kurita censoredsingle workSDNMsod createdainanahonmono hitodzuma dannani naisho de av taikenSDNM-294SDNM2941sdnm00294
    • 2021-07-10
    122 min

    [AUKG-516]Raw Spit Threading Lesbians

  • haruka nogi waka ninomiya censoredlesbianmature womanAUKGu kAUKG-516AUKG516aukg00516
    • 2021-08-07
    133 min

    [BADA-020]Breaking In Saya Mibari At The Masochist Club

  • minami saya censoredsingle workbukkakeBADAbarutanusubashi suidiamondBADA-020BADA020bada00020
    • 2021-08-07
    120 min

    [LUNS-077]60 Something Doggy Style 10

  • censoredcreampiemature womanLUNSluna shunkoushaLUNS-077LUNS077luns00077
    • 2021-08-12
    124 min

    [FSDSS-329]120 Minutes Of A Girl At The Creampie Baths Who Has Superior Techniques And Squeezes Out Semen Without End, Sora Shiina

  • shiina sky censoredcreampiesingle workFSDSSfalenoseijoui ishiifaleno starFSDSS-329FSDSS3291fsdss00329
    • 2021-08-21
    240 min

    [OKAX-767]Penis Addiction 2: The Girl Who Loves Hard Cocks And Gets Wet From Giving Head

  • rin kuramochi sakura mochizuki riko nanami censoredblowjobslutOKAXk m produceokazuOKAX-767OKAX767okax00767
    • 2021-09-05
    106 min

    [LOL-199]Y********l Specialty. Rough Sex From Step-father During Hellish Hot Springs Vacation With Masochistic Girl. Ten Hasumi

  • hasumiten censoredcreampiebeautiful girlLOLglayzrori senkaLOL-199LOL19912lol00199
    • 2021-09-08
    105 min

    241GAREA-519 Miu

  • amateur censoredcreampiebig titsgareagarea-519garea519241garea-519
    • 2021-09-08
    53 min

    444KING-047 Hinata

  • amateur censoredcreampiebig titskingking-047king047444king-047
    • 2021-09-10
    153 min

    [IPX-731]Relocation To A Farm NTR Transferred To The Middle Of Nowhere During Summer...The Mayor Goes After The Newlyweds And Has Sweaty Sex With The Wife Young Wife Who Accepts A Double Life Of Debauchery Despite Loving Her Husband Airi Kijima

  • airi kijima censoredcreampiesingle workIPXidea pocketdishIPX-731IPX731ipx00731
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-23
    124 min

    [GS-404]She"s Pretending To Be A****p, Unguarded, And Luring You In, Because She"s A Sweaty Little Devil, Your Little Stepsister!! One Hot Summer Day, While Our Parents Were Away, I Noticed My Little Stepsister"s Panties Were Dripping Wet

  • censoredsisterGSsosoru garconreddo bo ruGS-404GS4041gs00404
    • 2021-09-24
    134 min

    [SKMJ-209]*Barely Legal *Absolute No Condoms *A 19-Year Old Exposes Her Lust And Goes On A Hot Spring Resort Vacation *A 4-Fuck Extravaganza

  • censoredcreampieamateurSKMJsekimenjoshikantori wajimasekimen goshiSKMJ-209SKMJ209h-1324skmj00209
    • 2021-09-28
    71 min

    324SRTD-0246 Cheating Video Shooting To Attract Your Boyfriend! ？？ I Should Have Forgotten The Purpose And I’m Serious! (Moe Hazuki)

  • amateur censoredcreampieamateursrtdsrtd-0246srtd0246324srtd-0246
    • 2021-10-19
    58 min

    230OREC-900 Mr. Hoshitani (Hitomi Hoshitani)

  • amateur censoredcreampieamateurorecorec-900orec900230orec-900
    • 2021-10-25
    83 min

    374IMGN-028 Yu

  • amateur censoredamateurimgnimgn-028imgn028374imgn-028
    • 2021-10-30
    55 min

    [HEYZO-2647]Yui Kisaragi My Porcelain Skin GF Gets Fucked By Neighbour Old Fart

  • yui kisaragi uncensoredcreampiehandjobheyzo
    • 2021-11-12
    173 min

    [MIAA-528]100x More Pleasure Than A Sex Club!! A Men"s Massage Parlor Where You"ll Get Erotic Dirty Talk Whispered Into Your Ear While Your Dribble Pre-Cum All Over Her Tight, Pretty Ass As This Gal Slut Gives You So Much Nookie Your Brain Wi

  • tsukino luna censoredcreampieslutMIAAmoodyztorendei yamaguchiminna no kikatanMIAA-528MIAA528miaa00528
    • 2021-11-30
    48 min

    H4610 ki211130 Akina Koizumi 21years old

  • amateur uncensoredh4610
    • 2021-12-03
    136 min

    [JJCC-013]A Married Woman"s Overflowing Honey. Rieko

  • censoredcreampiemature womanJJCCjuku onna japan emmanuellejuku onna japanJJCC-013JJCC013jjcc00013
    • 2021-12-04
    107 min

    [XVSR-624]Exclusive 1st Anniversary. Shaved Pussy Document. Top Flower Shaved Pussy x Lesbian. Nanako Miyamura

  • ichibana mogami hana sato nanako miyamura censoredanalsquirtingXVSRmax asono kancalenXVSR-624XVSR624xvsr00624
    • 2021-12-10
    69 min

    FC2PPV 2504509 * Loli Big Breasts Revolution 2nd [National Treasure G Cup] Brush wholesale, fucking, middle 〇. I attacked the sneak peek and tried to squeeze the seeds

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored