amateur censored over hours older sister jav




FC2SDABNACXKSBJJUFECESDMILKSPRDSANMEYDHDKAMARAFSDSSABWJULMVSDEBODAVSAHMNLULUNACR

2020-11-19
172 min

[LZDQ-020]The Message Sent Through A Lesson In A Lesbian Adult Video - How These Two Ladies Spent All Day Loving Each Other -

  • ichika matsumoto hasumi claire censoredlesbianLZDQlesrenao masakirezure documentLZDQ-020LZDQ020lzdq00020
    • 2020-12-05
    119 min

    [JUL-399]Reunion At The After Party... She's Become A Married Woman Now But She Wants To Fuck As Much As Ever. Ema Asahi

  • chaoyang ema censoredcreampiebig titsJULmadonnahimu lockJUL-399JUL399jul00399
    • 2020-12-06
    240 min

    [YLWN-144]Busty MILFs Only! Can You Tempt A Business Hotel Massage Girl Into Sex？ 240 Minutes

  • censoredamateurmature womanYLWNyellow moonpappan tateishiYLWN-144YLWN144ylwn00144
    • 2020-12-10
    121 min

    [FSDSS-136]My Girlfriend's Little Sister Is An Excessively Sensual Premature Ejaculator Who Will Lure You To Time-Saving Temptation In High-Class Lingerie Sora Shiina

  • shiina sky censoredbeautiful girllingerieFSDSSfalenogoemonfaleno starFSDSS-136FSDSS1361fsdss00136
    • 2020-12-11
    94 min

    483SGK-006 [Glamorous Emperor] [Latin Big Breasts] [Open all year round horny beast] [Paipan] The 3 best Hs I’ve ever felt good about are … Rolls Royce, in the mountains, karaoke shops are abnormal, aren’t they？ Latin glamorous huge br

  • amateur censoredcreampiebig titssgksgk-006sgk006483sgk-006
    • 2020-12-28
    52 min

    FC2PPV 1623713 ☆ First shot ☆ Complete appearance ☆ Slender body beautiful girl with a dazzling smile is the first Gonzo and cum shot ♥ [With review benefits]

  • amateur uncensoredfc2
    • 2021-01-08
    162 min

    [HEZ-236]Married Women Share Their Adulterous Experiences! Let's Forget About Our Sins Together! A Threesome With Two Married Women Will Make You Feel Like A King! Luxury Pick Up Sex 3

  • censoredbig titssquirtingHEZhot entertainmentnetsuyujinhitotzuma hot entertainmentHEZ-236HEZ23659hez00236
    • 2021-01-15
    61 min

    FC2PPV 1638282 [Uniform Gonzo] Rui ☆ Special price ♪ Black hair twinte × uniform is a combination of royal roads ☆ Of course I will not take it off naked until the end (basic of cosplay etch) ★ Geki Saddle demon thrust [Review special

  • amateur uncensoredfc2
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-02-06
    121 min

    [SSNI-983]This Fresh Face Manager Will Usually Manage The Team With A Smile On Her Face, But The Truth Is She Cannot Physically Handle Being Around The Big Dick Team Members, But After The Game, They Were Pumped Up And Full Of Adrenaline, And So... L

  • kodama rena censoredsquirtingsingle workSSNIs1 no 1 stylesuisei akaiSSNI-983SSNI983ssni00983
    • 2021-03-03
    150 min

    [PFES-016]She's So Sensitive She Gets Wet Just Because Other People Are Around... S*********l In Uniform School Exhibitionist Training Erina Oka

  • hill erina censoredschoolgirlsingle workPFESmukusummer panties festivalPFES-016PFES016pfes00016
    • 2021-03-13
    146 min

    [JUFE-265]What Is Wrong With Cunnig Huge Tits？ Fucking Her Sister`s Boyfriend On the Weekend! Rena Momozono

  • reina taoyuan censoredcreampiebig titsJUFEfitchJUFE-265JUFE265jufe00265
    • 2021-03-25
    93 min

    [OKB-108]Big, Plump Asses - Godly Panties - Mitsuki Nagisa - Chubby Barely Legal Beautiful Girl In Sports Briefs And Athletic Wear With Bikini Line, Pussy Hair, And Slut Exposed - Incredible Close-Ups Of All Her Hairy Holes! Then Get An Assjob, Cloth

  • scooping censoredbukkakeOKBpersonal photography of fathergod bulmaOKB-108OKB1081okb00108
    • 2021-05-02
    86 min

    [VENX-032]This Horny Stepmom Started Lusting For Her Stepson's Morning Wood, So She Mounted Him Without Permission And Started Grinding Him With Cowgirl Sex Until She Came Karina Ayami

  • karina ayamizu censoredcreampiemature womanVENXvenuskaniefakecest winntersVENX-032VENX032venx00032
    • 2021-06-15
    47 min

    481SACZ-038 Sachiyo 4

  • amateur censoredamateurmature womansaczsacz-038sacz038481sacz-038
    • 2021-06-18

    FC2PPV 1874667 [Hinata Challenge] Yoshioka ◯ Hinata-chan, who looks like a sail, was so cute that she appeared!

  • amateur uncensoredfc2
    • 2021-07-01
    85 min

    435MFC-120 ["It feels better than your sister？"] Renka and raw SEX with twin erotic sisters who take pride in their feelings more than their sister Ma ● Ko! [Shiroto Gonzo ＃ Renka ＃ 24 years old ＃ Slender big tits]

  • amateur censoredcreampieamateurmfcmfc-120mfc120435mfc-120
    • 2021-07-05
    69 min

    493NAEN-066 [Back] Gonzo leaked from a former underground idol! Even if you cry, a fierce piston & a large amount of vaginal cum shot [Bonus 2nd round Gonzo video included Asahi Shizuku

  • amateur censoredamateurbeautiful girlnaennaen-066naen066493naen-066
    • 2021-07-05
    59 min

    493NAEN-067 [Back] Gonzo that trains a de M idol candidate with a big cock leaked from the office Kagami Sara

  • amateur censoredamateurbeautiful girlnaennaen-067naen067493naen-067
    • 2021-07-13
    47 min

    C0930 ki210713 Shinobu Bando 30years old

  • amateur uncensoredc0930
    • 2021-07-17
    58 min

    C0930 hitozuma1359 Kayo Nakatsui 29years Old

  • amateur uncensoredc0930
    • 2021-07-22
    126 min

    [JRZE-063]First Time Filming My Affair. Arisa Funaki.

  • arisa funaki censoredcreampiemature womanJRZEcenter villageminatoyajurakuJRZE-063JRZE063h-086jrze00063
    • 2021-07-23
    138 min

    [SKMJ-188]Angel's Tits "They're G-Cups" Rookie Misa Aihara's AV Debut

  • misa aihara censoredcreampiebig titsSKMJred face girlone topSKMJ-188SKMJ188h-1324skmj00188
    • 2021-07-27
    139 min

    [STARS-407]This Perverted Massage Therapist Was Sensually Massaging Her With Aphrodisiac Oils Until She Was Bending Over Backwards In Ecstasy And Pissing Herself With Pleasure! You Could See How This Horny College Girl Was Blossoming Into Her Sexual

  • aozora hikari censoredsquirtingsoloworkSTARSsod creategoemonsod starSTARS-407STARS407
    • 2021-07-30
    117 min

    [PRED-333]I"m Sorry! Forgive Me For Having So Much Thick Creampie Sex With Your Frustrated Girlfriend, Even Though You"re Letting Me Stay At Your Place... ! Yu Shinoda

  • shinoda yu censoredcreampiebig titsPREDpremiumkyaputen ebaraelegancePRED-333PRED333pred00333
    • 2021-07-30
    111 min

    [ADN-335]A Story Of Having Chaotic Sex With That Reserved Girl Who Works For A Municipal Office. Nanami Kawakami

  • kawakami nanami censoredsingle workdramaADNattackerssada oka sadaootona no dramaADN-335ADN335adn00335
    • 2021-08-16
    60 min

    10musume 081621_01 Amateur Av Interview: I Was Supposed To Do Bj Only, But Somehow I Started To Feel Really Good, And Wanted To Get Fucked Sae Sekine

  • amateur uncensored10musume
    • 2021-09-11
    61 min

    1Pondo 091121_001 Welcome To Luxury Spa: Shiori Yamagishi

  • amateur uncensored1pondo
    • 2021-10-01
    145 min

    [MIDE-979]Corrupted By An Unmatchable Mistress Who Lets Me Cum Inside Her While My Wife Is Away Visiting Her Parents, Starring Mizuki Aiga

  • mizuki ai censoredcreampieslutMIDEmoodyzoosaki hirokoujimoodyz divaMIDE-979MIDE979mide00979
    • 2021-10-08
    51 min

    FC2PPV 2315878 [Magnum Serious Raw Sex] ○ Li Beautiful Girl Who Continued To Persuade For 3 Months. She Puts In A Body That Can Not Be Helped Without Continuous Vaginal Cum Shot With Serious Magnum Sex. Thorough Dissection Of The Technique To Make A

  • amateur uncensoredfc2
    • 2021-10-14
    63 min

    1Pondo 101421_001 Welcome To Luxury Spa: Jessica Takizawa

  • amateur uncensored1pondo
    • 2021-11-01
    122 min

    [GOJU-190]"My Husband Won"t Look At Me As A Woman." A Wife With Colossal Tits Pleads To Appear In Porn Out Of A Desire To Still Indulge As A Woman Ms. Chiaki Age 48

  • censoredbig titsamateurGOJUisojinGOJU-190GOJU190h-1165goju00190
    • 2021-11-12
    123 min

    [BOBB-326]Boin "Rin Asahi" Boxed Set Beautiful Tits x Beautiful Big Tits A 20-Year Old Former Idol Receives An Initiation Into Her First Experiences With A Big Tits Freak! Enjoy To The Fullest Her Amazing, Lusty Body As She Performs Every Tit

  • rin asahi censoredbig titsbeautiful girlBOBBabc mousou zokuboinbb abc mousou zokuBOBB-326BOBB326bobb00326
    • 2021-11-12
    243 min

    [SKMJ-225]These Amateur Girls Are Visiting The Home Of A Maso Man! These Innocent Girls Had Practically No Experience In The Art Of Making The First Move, But When His Endless Maso Soul Touched Their Hearts, It Triggered The Blossoming Of Their Sadis

  • censoredcreampieamateurSKMJblush girlxyzSKMJ-225SKMJ225h-1324skmj00225
    • 2021-11-17
    74 min

    534IND-011 White Gal Best Beauty / Facial Cumshot / Creampie 2 Shots, Wet Man Geki Pis Video Leaked With Insanely Guarantee * Masturbation Too Much Warning * (Hakuto Wana)

  • amateur censoredcreampieamateurindind-011ind011534ind-011
    • 2021-11-19
    236 min

    [HUNTB-147]"You Saw My Underwear Just Now, Right？" A Perverted Lady Tries To Give Me A Boner With A Suggestive Panty Shot That Has To be On Purpose With The Way She Spreads Her Legs

  • censoredcreampieslutHUNTBhuntermorikihhh groupHUNTB-147HUNTB147huntb00147
    • 2021-11-19
    89 min

    AVKH-205 Ayaka (Ayaka Muto)

  • amateur censoredcreampieamateuravkhavkh-205avkh205avkh-205
    • 2021-11-19
    116 min

    [SSIS-245]How A Gambling Addict Like Me Who Loves Liquor Got A Married Model-Tier Babe To Fuck Me Every Day Ichika Hoshimiya

  • ichika hoshimiya censoredsingle workSSISs1 no 1 stylenikusonSSIS-245SSIS245ssis00245
    • 2021-11-20
    137 min

    [APAK-206]~I"m Going To Be Destroyed...PH

  • squid censoredcreampieschoolgirlAPAKaurora project annexrkaurora project anexAPAK-206APAK206apak00206
    • 2021-11-20
    135 min

    [APKH-191]Beautiful Breasts School Uniform Girl, Hot Spring Trip With A Dominant Teacher And Creampie Sex Education.

  • yoshimi hono censoredcreampieschoolgirlAPKHaurora project annexhaurora project anexAPKH-191APKH191apkh00191
    • 2021-11-26
    120 min

    [EMSK-001]The ASMR Men"s Esthetic Salon, Where The Sound Of Whispering And Squealing Will Melt Your Ears. Yumi Saeki

  • yuka saeki censoredblowjobslutEMSKwaap entertainmentk westcobra warpEMSK-001EMSK0012emsk00001
    • 2021-12-10
    166 min

    [IPX-785]Deep Drooling Saliva Swapping Kiss And Creampie Sex With Beautiful Girl. Amiri Saito

  • amiri saito censoredcreampieblowjobIPXidea pocketdishIPX-785IPX785ipx00785
    • 2021-12-23
    121 min

    [FSDSS-334]Convulsions, Shrimping, Cumming, Extreme Climax, Vagina Bug Juice, Awakening Trance Orgasm Sex Rin Natsuki

  • rin natsuki censoredsquirtingFSDSSfalenoskyscraperfaleno starFSDSS-334FSDSS3341fsdss00334
    • 2021-12-29
    57 min

    H0930 ori1619 Sayaka Yoshioka 29years old

  • amateur uncensoredh0930
    • 2022-01-02
    65 min

    SIRO-4751 [First Shot] [Soft Beautiful Breasts] [Massive Squirting] A Nursing Student Whose Cowgirl Stakeout Is Too Erotic Appears. The Body Is Flushed By The Advance Of The Penis, And It Cums Continuously With A Fluffy Face .. Av Application On The

  • amateur censoredsquirtingamateursirosiro-4751siro4751siro-4751
    • 2022-01-07
    100 min

    393OTIM-099 [Delusional Subjectivity] I’m Sorry For Being Lewd And Vulgar. I Came Because I Wanted To Have An Affair. Sho Suzume

  • amateur censoredcreampiebig titsotimotim-099otim099393otim-099
    • 2022-01-07
    118 min

    [DASD-958][Against her Better Judgment] Aphrodisiacs from her Loathed Ex-Boyfriend Lead to Her Body Quaking in Pleasure and Her Skin Covered with Cum. Wild Sex Full of Ecstasy. Yu Shinoda

  • shinoda yu censoredcreampiebig titsDASDdasrokusaburo mishimaDASD-958DASD958dasd00958
    • 2022-01-12
    40 min

    FC2PPV 2587359 [Personal Shooting / Set Sale] A Luxury Hotel Receptionist Who Was Called For The First Time In A Long Time.

  • amateur uncensoredfc2
    • 2022-01-21
    169 min

    [SSIS-305]Izuna Maki"s Retirement Porn Star"s Best Ever Show-Stopping Aphrodisiac Sex! 3 Rounds

  • izuna maki censoredsquirtingsingle workSSISs1 no 1 stylemon cSSIS-305SSIS305ssis00305
    • 2022-02-04
    146 min

    [IPX-807]Crazy Room Sharing Scenario With A Dreadful Boss At A Hot Springs Inn During A Business Trip.... Disgusting Older Guy Gives Me Endless Pleasure With Non-stop Fucking. Iyona Fujii

  • iyo fujii censoredsingle workdramaIPXidea pocketdishIPX-807IPX807ipx00807
    • 2022-02-12
    137 min

    [GVH-360]My Step-mom That Loves Me And My Friend"s Mom That"s The Most Beautiful Of Our Whole Class Go On A Shared Bath Hot Springs Vacation With Me For 2 Nights And 3 Days. Yuri Oshikawa , Minami Oura

  • yuri sugawa manami oura censoredcreampieGVHglory questhyonGVH-360GVH360gvh00360
    • 2022-02-19
    138 min

    [HALT-003]Seducing Two Job Seeking Sluts With Colossal Tits Lick Their Rock-Hard, Erect Nipples!! Round-Assed Hot MILFs Get Rocked For Real Hear Them Beg To Get Creampied

  • censoredcreampiebig titsHALThalentino daydream tribehalentinocomplete amateur match making partyHALT-003HALT003halt00003
    • 2022-02-19
    232 min

    [ROOM-035]S********ls For Rent: A, B, Or C - Which Cup Size Is Your Favorite？

  • censoredcreampieuniformROOMhomeroom daydream tribehomeroom homeroom daydream tribeROOM-035ROOM035room00035
    • 2022-02-23
    49 min

    FC2PPV 2681249 [1 Week Limited 3480 → 2480] [Face Exposure / Sanctions] That Child In The Example. I Was Flirting In The City, So I Sanctioned The Group.

  • amateur uncensoredfc2
    • 2022-02-26
    126 min

    [BDSR-472]Career Advisor With Super Lewd Big Tits Has Non-stop Sex With Someone Looking For A New Job. Mei Hosho

  • mei hosho censoredsingle workBDSRbig morkalyumejiBDSR-472BDSR47257bdsr00472
    • 2022-02-28
    68 min

    274DHT-0402 Mischief To A Girl With Big Tits Glasses ＃ 01 (Yuka Chiba)

  • amateur censoredcreampiebig titsdhtdht-0402dht0402274dht-0402



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored