amateur creampie def censored javcensored




FC2AUKSSTARSWANZMARAHZGDNACRHUNTBROYDWAAAMILKPPPDFSDSSCAWDSPRDCHRVGVHATIDNACXLULUMVSD

2020-12-19
66 min

SIRO-4330 [First shot] [Minato-ku girls x work end] [Idol employee’s foolery] Minato-ku OL, who has only popular elements, takes the first AV shot at the end of work. The way the idol face turns into pleasure is definitely in the main story .. A

  • amateur censoredamateursirosiro-4330siro4330siro-4330
    • 2020-12-21
    100 min

    [HAHOB-024]We Found A Members Only Lounge By The Harbor Where The Girls Do Non-Nude Erotica! Sari Nagahama

  • censoredbig titsbeautiful girlHAHOBhapiness holicHAHOB-024HAHOB024h-706hahob00024
    • 2020-12-21
    107 min

    [DUVV-031]We Discovered This Music S*****t In Akita, And Now She's Making Her Pregnant Adult Video Debut Ichika Hasumi

  • hasumi ichika censoredcreampiebig titsDUVVtoyohikotoyohikotoyohiko planningDUVV-031DUVV031duvv00031
    • 2020-12-31
    123 min

    [JRZE-019]It's My First Time Filming My Affair Sanae Matsuyama

  • sanae matsuyama censoredcreampiemature womanJRZEcenter villagedaichi minamijurakuJRZE-019JRZE019h-086jrze00019
    • 2021-01-08
    118 min

    [IENF-119]I Never Once Thought About Fucking My C***dhood Friend Because She Was Such A Tomboy, Until The Day I Accidentally Touched Her Big Tits! I Rubbed Them And She Seemed To Love It So We Went All The Way To Creampie Sex

  • aya mitsuki kisaragi mashiro censoredcreampiebig titsIENFienergytiger kosakaiienfIENF-119IENF1191ienf00119
    • 2021-01-12
    121 min

    [GONE-027]Naugthy Madame Kuromoto Yan`s Enamel Bondage FUCK Slutty To The MAX!! NiceBondage

  • censoredcreampiebig titsGONEmercuryan erotic tanned elder sisterGONE-027GONE027h-1133gone00027
    • 2021-01-15
    150 min

    [SCOP-703]Finally Found It! This Little Brothel Is Out In The Middle Of Nowhere, Peacefully Making Modest Bank, But Unlike Most Brothels These Days You Can Creampie The Girls There! Don't Miss This Rare Experience - They'll Drain Your Balls D

  • censoredcreampiebig titsSCOPscoopjohnny shibuyamousouzokuSCOP-703SCOP703h-565scop00703
    • 2021-01-21
    40 min

    FC2PPV 1653242 [Virgin x K Cup] F〇7 Tee Big Breasts K Fucking / Creampie! Virgin-kun forgets himself in the overwhelming size of clothes fucking and makes his dream come true * Nothing to do! * Complete appearance, vaginal cum shot, graduation from v

  • amateur uncensoredfc2
    • 2021-01-30
    40 min

    H0930 ki210131 Misa Ishida 32years old

  • amateur uncensoredh0930
    • 2021-01-31
    154 min

    [MMKZ-091]Cute Face, Big Butt! Natsu Tojo

  • natsu tojo censoredsingle workMMKZmarrionkojiro miyamotoirisMMKZ-091MMKZ091mmkz00091
    • 2021-02-03
    55 min

    345SIMM-603 Sex as soon as my father goes out! A young mother-in-law and her son seek each other like lovers at home alone …

  • amateur censoredcreampiebig titssimmsimm-603simm603345simm-603
    • 2021-02-11
    161 min

    [SPRD-1378]My Old Fuck Buddy Was My Friend's Mom - Nao Nakano

  • nanao nakano censoredmature womansingle workSPRDtakara eizokon oriharualeddinSPRD-1378SPRD137818sprd01378
    • 2021-02-11
    138 min

    [IESP-676]Suzu Monami: Lesbian Unleashed - I Fell In Love With My Step-sister

  • monami bell toua kotone censoredlesbiandramaIESPienergykikuriniespIESP-676IESP6761iesp00676
    • 2021-02-19
    119 min

    FC2PPV 1692217 31: [Individual shooting] A classmate of the metropolitan commercial department, a mysterious beautiful girl. [4K image quality]

  • amateur uncensoredfc2
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-25
    54 min

    H0930 ki210225 Kazumi Ikeda 37years old

  • amateur uncensoredh0930
    • 2021-02-26
    79 min

    230OREC-706 Mirei

  • amateur censoredcreampiebig titsorecorec-706orec706230orec-706
    • 2021-03-02
    135 min

    [STARS-336]Her 4th Year As A Porn Star: Yuna Ogura Will Come To Your Place To Satisfy Your Sexual Needs! Limitless Raw Creampie Sex At A Members-Only Triple-Star Soapland

  • yuna ogura censoredcreampiebeautiful girlSTARSsodzach araiSTARS-336STARS3361stars00336
    • 2021-03-06
    103 min

    FC2PPV 1714775 [First time limited 2980 → 1980] 18 years old who just graduated on March 1 ❤️ "Today my uncle will make the first vaginal cum shot in my life" ❤️ 1 experienced person ❤️ Backflow pops out at the same time as Ahan ❤️ Massive sp

  • amateur uncensoredfc2
    • 2021-03-13
    29 min

    H4610 ki210313 Self Shot

  • amateur uncensoredh4610
    • 2021-03-24
    99 min

    240TOKYO-424 Minami

  • amateur censoredamateurcosplaytokyotokyo-424tokyo424240tokyo-424
    • 2021-03-26
    61 min

    328HMDN-348 [Individual, 60th Road] Miraculous 60th birthday wife 60 years old. Experience her climax for the first time in a quarter century by rich copulation with her youth and the tag comes off and begs for vaginal cum shot

  • amateur censoredcreampieamateurhmdnhmdn-348hmdn348328hmdn-348
    • 2021-04-01
    189 min

    [YMDD-210]Quickie Interviews With Shiro Mitsuboshi 2 - They Only Came To Talk, But Before They Knew It They Were Getting Drilled

  • kurosaki mika asami rena censoredcreampieamateurYMDDmomotaro eizoasakusa ga jirowakamomoYMDD-210YMDD210
    • 2021-04-01
    119 min

    [VIO-012]Super Beautiful Butts Getting Fucked: Breaking In Thick Lesbian Massage Parlor

  • censoredanallesbianVIOlahaina tokaivioletVIO-012VIO012h-189vio00012
    • 2021-04-08
    265 min

    [TUS-095]【MGSだけのおまけ映像付き 25分】120リアルガチ軟派伝説 vol.95 遠出せずともナンパは出来る！町田で発掘エロ娘！

  • amateur censoredcreampiebig titstustus-095tus095tus-095
    • 2021-04-08
    245 min

    [NHDTB-514]Whenever My Wife Is On The Phone I'm Disciplining Her Bitchy Little Sch**lgirl Daughter With Endless Creampie Sex 3

  • censoredcreampieNHDTBnatural highsakurai vanillaNHDTB-514NHDTB5141nhdtb00514
    • 2021-04-14
    162 min

    [DVDMS-655]Ordinary Guys And Girls Caught On Camera - Coworkers With Colossal Tits Get Tipsy, Hit On Their Boss, And Make Him Give Them Creampie Fucks Until Dawn (Role Reversal) 2

  • censoredcreampiebig titsDVDMSdeep sswing nagaseDVDMS-655DVDMS655dvdms00655
    • 2021-04-18
    260 min

    [APAE-068]Getting Off For 260 Minutes On Nene Tanaka!

  • nene tanaka censoredcreampiebig titsAPAEaurora project annexh nasuyukiaurora project exAPAE-068APAE068apae00068
    • 2021-04-30
    67 min

    H0930 ki210502 Kitasaka Kaname 36years old

  • amateur uncensoredh0930
    • 2021-05-05
    52 min

    FC2PPV 1803283 [2980 → Limited number 1980] Anxious about her husband’s barre and seeing this ❤ Serious beautiful wife working at the station ❤️ Unprocessed pubic hair ❤️ Lie to her husband Sex overtime ❤️ Gachi NTR excitement 2 consecutive vagi

  • amateur uncensoredfc2
    • 2021-05-13
    119 min

    [ZEAA-061]Bukkake Masochistic Wife Beautiful Masochistic Wife Gets Covered In Cum By Group Of Men Kayo Iwasawa

  • kayo iwasawa censoredmarried womanmature womanZEAAcenter villagesky cloudsthe pole center villageZEAA-061ZEAA061h-086zeaa00061
    • 2021-05-14
    45 min

    FC2PPV 1798960 Vacuum blowjob with plenty of saliva ♡ Thick semen bukkake on the face of a perverted erotic wife Massive facial cumshots ♡ Main story appearance ♡ Personal shooting 73

  • amateur uncensoredfc2
    • 2021-05-15
    42 min

    FC2PPV 1819137 [Personal shooting] ♀ 201 Female college student Mi ◯ -chan 19 years old 8th time AV actress who squeezes the sperm of Ojisan with Dirty Little water costume JD beautiful girl!

  • amateur uncensoredfc2
    • 2021-06-04
    120 min

    [ADN-321]I Got A Girlfriend For The First Time And The Older Neighborhood Girl Taught Me How To Have Sex Kana Kusakabe

  • kana kusakabe censoredcreampiebig titsADNattackerskitorune kawaguchiotona no dramaADN-321ADN321adn00321
    • 2021-06-17
    129 min

    [TOEN-043]Whenever Her Husband Takes A Short Break, Her Big Brother-In-Law Hits Her With Over 10 Creampie Cum Shots, Every Single Day ... Mio Saionji

  • mio saizonoji censoredcreampiemarried womanTOENcenter villageyoichi sanotaoyuanTOEN-043TOEN043h-086toen00043
    • 2021-06-19
    120 min

    [HND-996]A Fresh Face Girls Like This Really Exist! A Highly-Educated Dick-Eating Real-Life National University S*****t Is Begging To Be Fucked By An Erotically Intelligent Adult Video Actor And Cumming Together In Creampie Ecstasy During Her Adult V

  • mitsu kano censoredcreampieHNDbooktiger gavelHND-996HND996hnd00996
    • 2021-06-20
    123 min

    [OIGS-039]Housewife Addicted To Bondage Play! While My Husband's Away, I'm My Ex-BF's S&M S***e. Kana Morizawa

  • kana morisawa kanako iioka censoredmature womanbdsmOIGSavs collector susubashisuiavscollector sOIGS-039OIGS039oigs00039
    • 2021-07-02
    53 min

    FC2PPV 1882727 [Personal shooting] Chitose 26 years old Massive launch to delicate and petite newlywed Lori erotic man wife

  • amateur uncensoredfc2
    • 2021-07-14
    127 min

    [ARM-999]How Would You Like To Have Your Hard Cock Secured Up Against Your Stomach While Being Roughly Jacked Off？

  • blue miu susaki censoredsluthandjobARMaroma planningshigeo kadowakiaromaARM-999ARM999arm00999
    • 2021-07-18
    121 min

    [GENM-086](Hina Shinjo) You'll Find Yourself Wanting To Lift This Cute Shortstack With G Cups Off The Ground!

  • hina shinjo censoredbig titsbeautiful girlGENMgenekigoldfish dGENM-086GENM086genm00086
    • 2021-08-13
    123 min

    [FOCS-015]Debut Kabuki Hostess Princess! She"s New But Brings In The Money, Thrusting Her Lower Body With Her Tongue Out From Morning! All You Can Fuck, Sarina Momonaga

  • sarina momonaga censoredsingle workFOCSabc mousou zokufocusFOCS-015FOCS015focs00015
    • 2021-09-10
    156 min

    [IPX-726]A Lucky Lady Who Gives Instant Hard Ons Sucks Cock Once She Is Called The Best Blowjob Giving Girlfriend. "I Want All Of Your Cum In My Mouth" (9 Continuous Oral Cumshots!!) Kana Momonogi

  • kana momonogi censoreduniformblowjobIPXidea pocketkyoseidishIPX-726IPX726ipx00726
    • 2021-09-14
    34 min

    FC2PPV 2201398 [New Work, Half Price! ] ♀43 Professional Student Mi ◯ -Chan 20 Years Old 1st Time (3p) Blindfolded ◯ A Black Man Cheated In A Bundle And Made An Unauthorized Vaginal Cum Shot! Is The Second Undesired Unfortunate Pregnancy A Half-Baby!

  • amateur uncensoredfc2
    • 2021-10-01
    139 min

    [JUNY-044]The Long Awaited Bondage Reveal! Tight Ropes Dig Into This Athlete"s Fleshy Body And Huge Ass As She Undergoes Special Training, Starring Rio Ohara

  • osamu osamu censoredsquirtingbdsmJUNYfitchnikuyokuJUNY-044JUNY044juny00044
    • 2021-10-02
    103 min

    [SQTE-383]Lost In Sena"s Body: You"ll Be Unable To Stop Yourself From Masturbating With Her G-Cups And Fetishes On Full Display! Starring Sena Kasumi

  • sena kasumi censoredbig titssquirtingSQTEs cutes cute s cuteSQTE-383SQTE383sqte00383
    • 2021-10-02
    64 min

    FC2PPV 2284849 [Virgin Festival] First Shot Lori Big Breasts Gently Brush Down Three Virgins. I Can’T Tell You Everything Because I’m Too Good * Fucking, Vaginal Cum Shot, Cum Swallowing

  • amateur uncensoredfc2
    • 2021-10-08
    122 min

    [ACZD-001]A College Girl With A Taste For Masochism

  • censoredamateurbdsmACZDsanwa shuppanabnormal.companiesACZD-001ACZD001h-019aczd00001
    • 2021-10-09
    129 min

    [DNJR-060]Urethral Violation School

  • ichika matsumoto rina takase censoredsluthandjobDNJRinu mousozokunikukuso tei haramiDNJR-060DNJR060dnjr00060
    • 2021-10-13
    59 min

    230OREC-898 Osuga-San (Ruru Cha. )

  • amateur censoredcreampieamateurorecorec-898orec898230orec-898
    • 2021-11-08
    51 min

    [ETQR-305][Daydream POV] Bashful, First-Time SEX for a Fresh Face, Shun Li, from Hong Kong

  • haruri censoredcreampieblowjobETQRerotic timeETQR-305ETQR305etqr00305
    • 2021-11-26
    85 min

    467SHINKI-067 "Favorite Girl" [Train Molester] [Home Voyeur] [Sleep Rape] A Talented Person In 100 Years Floral Pattern White P (Nanami Yokomiya)

  • amateur censoredcreampieuniformshinkishinki-067shinki067467shinki-067
    • 2022-01-01
    46 min

    491TKWA-209 5 Koharu Hanasaki Put Out In This Daughter

  • amateur censoredcreampieuniformtkwatkwa-209tkwa209491tkwa-209
    • 2022-01-07
    185 min

    [UMD-811]I Had My Balls Drained Completely Dry By Horny Older Women

  • kiyoshi maihara shinoda yu censoredbig titsslutUMDleotabu osakiUMD-811UMD811125umd00811
    • 2022-01-29
    57 min

    [h0930-ori1620]浦田 麻美子 44歳

  • amateur uncensoredh0930
    • 2022-02-03
    237 min

    [STSK-013]Apartment Style High Class Men"s Massage Parlor. Lewd Treatment For A Creampie Secret Option. All Peeping.

  • censoredcreampiebig titsSTSKamateur 39STSK-013STSK013h-1605stsk00013
    • 2022-02-19
    242 min

    [UMSO-435]Secret Affair With Middle Aged Men POV Footage Of 10 Married Women Enjoying Fucking Around vol. 03

  • kana suruga ayaka makimura censoredmature womanUMSOk m produceumanamiUMSO-435UMSO435umso00435



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored