amateur high vision housewife big tits censored




FC2EBODSHKDJULNNPJNGODAUKSMVSDGVHHMNMIAAWAAASANMARAMILKNACRPREDKSBJRBDMIDESQTE

2020-11-14
49 min

H0930 tk0024 Hisako Tsubahara 33years old

  • amateur uncensoredh0930
    • 2020-11-20
    206 min

    [ABW-026]Sexual Awakening, Tasting Godly Milk From H-cup Tits: Super Erotic Colossal Tits, Super Masochistic Cumming 3 - Konomi Nagisa

  • nagisa konomi censoredbig titssquirtingABWprestigesamansa tabataabsolutely wonderfulABW-026ABW026118abw00026
    • 2020-11-24
    64 min

    SIRO-4327 [First shot] [Transformation of a neat beauty] [Daze climax] The frustrated editor is a generalized erogenous zone. The soft touch makes the body flutter, and it is so crazy that it is stunned with a meat stick for the first time in 3 years

  • amateur censoredamateursirosiro-4327siro4327siro-4327
    • 2020-12-08
    483 min

    [KTRA-262]Younger Sister With Big Tits Has Continuous Sex With 10 People vol. 5

  • miyu saito haruka ogura censoredcreampiebeautiful girlKTRAk tribeKTRA-262KTRA262h-094ktra00262
    • 2020-12-10
    71 min

    230OREC-652 Nana

  • amateur censoredcreampieamateurorecorec-652orec652orec-652
    • 2020-12-10
    214 min

    [NHDTB-469]She Was On An Overnight Bus And Unable To Make A Sound While She Came As She Got Fucked Raw With Slow Piston-Pumping Strokes And Lost Her Mind To The Pleasure Of It All And Couldn't Refuse His Creampie Fucking S********ls Only 6

  • censoredcreampieschoolgirlNHDTBnatural highjanken kotamaNHDTB-469NHDTB4691nhdtb00469
    • 2020-12-10
    106 min

    485GCB-004 There is nuki, there is laughter, there is tears! Document AV monument, Bakusei! !! !! G cup big breasts beauty helps graduation from virginity ♪ Fair-skinned beauty with overwhelming beauty body boldly escorts! God open the heart of a vir

  • amateur censoredbig titsamateurgcbgcb-004gcb004485gcb-004
    • 2020-12-20
    127 min

    [DASD-786]Ever Since We Let My Colleague Stay At Our House, My Wife Has Loosened Up Her Stance. A Married Woman Commits Black Dick NTR Mio Kimijima

  • kimishima mio censoredbig titssingle workDASDdasrokusaburo mishimaDASD-786DASD786dasd00786
    • 2020-12-25
    82 min

    [VNTG-024]She's Riding The Super Ero-1 Box Car And Her Heart Is Breaking With Shame! - She's A Maso Bitch Who Falls For The Pleasure Of Shame! - Wakana

  • wakana ai censoredVNTGorustak picturesVNTG-024VNTG024
    • 2020-12-26
    160 min

    [WAAA-025]My Condom Broke, And To Our Surprise, We Were Fucking In The Raw! As My Piston-Pounding Strokes Began To Accelerate, I Creampie Fucked Her Over And Over Again! Hinata Koizumi

  • hinata koizumi censoredcreampiebig titsWAAAwanz factorywanzWAAA-025WAAA025waaa00025
    • 2021-01-08
    73 min

    259LUXU-1364 Luxury TV 1350 God’s lower body receptionist! Big and tight buttocks and thighs! The angle that sways from behind is just superb! !! The high-pitched pant that leaks every time it shakes also invites excitement!

  • amateur censoredamateurluxuluxu-1364luxu1364259luxu-1364
    • 2021-01-19
    59 min

    383REIW-021 Miharu

  • amateur censoredamateurbeautiful girlreiwreiw-021reiw021383reiw-021
    • 2021-01-22

    FC2PPV 1654888 [Personal shooting] A fair-skinned bristle man hair beautiful girl is made into a toy of two stranger sticks.

  • amateur uncensoredfc2
    • 2021-01-31
    14 min

    FC2PPV 1666678 (Limited time) Selfie neighborhood_a01_former underground idol_raw Gonzo

  • amateur uncensoredfc2
    • 2021-02-05
    115 min

    [PARATHD-3104]The Top 10 Most Beautiful Massage Girls In Our Series' History! Knock-Out Babes Bust Your Nuts With Their SK**lful Erotic Manipulations - Masseuse Special

  • censoreduniformamateurPARATHDparadise tvPARATHD-3104PARATHD3104parathd03104
    • 2021-02-06
    164 min

    [PRED-285]What If You Were Alone With Aika Yamagishi？... Sweaty, Passionate, Secret Situations With A Born Slut

  • aika yamagishi censoredcreampieblowjobPREDpremiummametaro mamezawaelegancePRED-285PRED285pred00285
    • 2021-02-08
    82 min

    498DDH-001 Frustrated tipsy female boss is reverse sexual harassment! ？？ Became a shared room at a hotel on a business trip, straddling a busty boss who flickers a woman’s face and raw SEX until morning

  • amateur censoredcreampiebig titsddhddh-001ddh001498ddh-001
    • 2021-02-20
    116 min

    [OFKU-173]My Wife's Mother Is Visiting Again From Ibaraki... Panty Shot Mother In Law Yasuko Ogata 50 Years Old

  • yasuko ogata censoredcreampiemature womanOFKUstar paradiseofukuro tetsudouOFKU-173OFKU173h-254ofku00173
    • 2021-02-21
    165 min

    [HND-946]When I Started To Gasp For Air, She Covered My Mouth With Slobbering Kisses And Even When My Cock Started To Bug Out, She Wouldn't Stop Pounding Me With Piston-Powered Creampie Thrusts Because She Was A Kissing Cowgirl Elder Sister Type

  • mitani akari censoredcreampieslutHNDhon nakanao masakiHND-946HND946hnd00946
    • 2021-02-21
    32 min

    FC2PPV 1696338 [No] A young wife with tall and beautiful legs. She sells her body to the end of a gambling addiction.

  • amateur uncensoredfc2
    • 2021-02-25
    49 min

    [orec-697]のぞみ

  • amateur censoredcreampiebig titsorecorec-697orec697orec-697
    • 2021-03-11
    151 min

    [NHDTB-501]My Friend's Sexy Sister With A Huge Ass I Fucked Her Cowgirl Style Until My Balls Were Empty

  • censoredcreampieslutNHDTBnatural highlemon heart nakajimaNHDTB-501NHDTB5011nhdtb00501
    • 2021-03-26
    59 min

    [WKD-040]A Woman's Fall Yuri Honma

  • really censoredbig titsslutWKDwaap entertainmentk westwWKD-040WKD0402wkd00040
    • 2021-03-29
    46 min

    292MY-432 Anri Shinomiya 2

  • amateur censoredcreampiebig titsmymy-432my432292my-432
    • 2021-04-08
    93 min

    [OKB-109]A Voluptuous Big Ass A Goddess In Bloomers Shion Natsume From A Lolita Beautiful Girl, To A Chubby Girl, We Dressed These Hot Bitches In Tight Bloomers And Gym Shorts So We Could See Their Asses And Cameltoes Bulging Out So Hard Their Pussy

  • shion natsume censoredschoolgirlsingle workOKBdaddy s private photosgoddess in bloomersOKB-109OKB1091okb00109
    • 2021-04-09
    147 min

    [MIDE-907]Brand New Office Girl Is Made By Her Nasty Boss To Model Sexy Lingerie Rei Futami

  • rei futami censoredlingeriesingle workMIDEmoodyzmametaro mamezawamoodyz divaMIDE-907MIDE907mide00907
    • 2021-04-14
    176 min

    [ROYD-052]"If They're Bothering You So Much, Feel Free To Touch Them!" I Couldn't Look Away From My Colossal Tits Private Tutor's Enormous Busty, So She Let Me Have My Fill Of Them Until I Busted My Nut Yukino Nagisa

  • yukino nagi censoredcreampiebig titsROYDroyalcognac kaminohhh groupROYD-052ROYD052royd00052
    • 2021-04-14
    123 min

    [GVH-221]Ass-Loving Shota-kun's Lewd Prank Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiesingle workGVHglory questtsunemori takahashiGVH-221GVH22113gvh00221
    • 2021-05-07
    122 min

    [FSDSS-215]The Serious And Super Smart College Girl Who Was Number One In Our Class Turned Out To Be A Super Popular Escort With Sexiness Levels Off The Chart And A Shaved Pussy Meisa Kawakita

  • kawakita meisa censoredblowjobbeautiful girlFSDSSfalenoboomer 44faleno starFSDSS-215FSDSS2151fsdss00215
    • 2021-05-26
    45 min

    FC2PPV 1837852 [First shot / 45 minutes 6 shots] 144cm Former child role After 10 years, continuous cum swallowing 6 consecutive debuts Uncut cum swallowing cum ＃ 11

  • amateur uncensoredfc2
    • 2021-05-27
    215 min

    [DOCP-296]某デリヘルで隠し撮り映像がダダ漏れ！人気美人嬢の接客術は本番必至！！？調子に乗った客が中出しまで！最高盗撮映像4名

  • amateur censoredcreampiebig titsdocpdocp-296docp296docp-296
    • 2021-06-04
    117 min

    [SHKD-949]Newly Wed Teacher Kaori Has Been Made Into A Sex Toy By The School Hooligans Nanami Kawakami

  • kawakami nanami censoredsingle workdramaSHKDattackerskitorune kawaguchisharkSHKD-949SHKD949shkd00949
    • 2021-06-12
    120 min

    [GMA-020]Breaking In Wives With S&M - Naughty Father-In-Law Preys On Horny Married Woman - The Day They Can Never Come Back From, Irresistible Adulterous Pleasure... Ku Akane Fuji

  • akane kudo censoredmature womanbdsmGMAglobal media annexkaiGMA-020GMA020gma00020
    • 2021-06-20
    130 min

    [NASH-529]This Horny Housewife Loves Cocks, And Now She's Going Behind Her Husband's Back To Have A Secret Meeting With Her Partner In Infidelity And Engage In Plenty Of Deep And Rich Sex So That She Can Satisfy Herself With Her Favorite Deli

  • censoredblowjobNASHnadeshikomitsuo okuNASH-529NASH529nash00529
    • 2021-06-29
    139 min

    [MSFH-064]The Section Chief Slathered Her With Aphrodisiacs ... During Their Business Trip, She Was Booked Into The Same Room At The Hot Spring Resort Inn With Her Boss (Whom She Hated With A Passion), And Now He Was Fucking Her Brains Out Konomi Yos

  • konomi yoshinaga censoredsingle workdramaMSFHsod createinugami ryoums sodMSFH-064MSFH0641msfh00064
    • 2021-06-30
    65 min

    FC2PPV 1896545 [This is a miracle! ] God correspondence with a beautiful voice so that the complaint of the product disappears ♥♥ She met in real life She was a beautiful person after all ♥♥

  • amateur uncensoredfc2
    • 2021-07-09
    66 min

    FC2PPV 1912208 [Limited] Wakeari’s first active Gonzo.

  • amateur uncensoredfc2
    • 2021-07-10
    121 min

    [AVSA-173]Bukkake, Nasty Splash Big Ass Masochist Man Fuck, Sperm Bukkake Splashes All over Her Ass!! Ai Mukai

  • ai mukai censoredslutsingle workAVSAavs collector shikaru jingujiavscollector sAVSA-173AVSA173avsa00173
    • 2021-07-12
    98 min

    300MIUM-724 I’m Dissatisfied With Ordinary SEX! [Genuine] Abnormal! !! [Restriction x Blindfolded, you can’t get excited] x [Inflate the delusion that is tied up even when masturbating] x [Dignified affair, dignified restraint, dignified sq

  • amateur censoredcreampiemarried womanmiummium-724mium724300mium-724
    • 2021-07-15
    119 min

    [HALE-005]Devouring Young MILFs: Infinite Loop Vol. 5 Rika - Cute Face, Big Booty, Screaming Orgasm, Semen-Swilling MILF

  • censoredbig titsamateurHALEhalentino daydream tribehalentinoinfinite loop eating my mom s frienHALE-005HALE005hale00005
    • 2021-07-29
    92 min

    [FUGA-049]The Wife Who Will Fuck The Criminal To Get Back Her K****pped Husband: Yuka Mizuno

  • yuka mizuno censoredcreampiemarried womanFUGAcenter villagejiro fukagawaparadise center villageFUGA-049FUGA049h-086fuga00049
    • 2021-08-05
    113 min

    1Pondo 080521_001 Shino Aoi Megu Memesawa : Sexy Actress Special Edition Shino Aoi Megu Memezawa

  • amateur uncensored1pondo
    • 2021-08-10
    240 min

    [KTRA-321]Blowjob From A Beautiful Girl Who Looks At You Kate Live POV Blowjob: The BEST 4 Hours With Sixteen Girls

  • yui nagase toua kotone censoredblowjobbeautiful girlKTRAk tribeKTRA-321KTRA321h-094ktra00321
    • 2021-08-14
    122 min

    [MKD-229]J-cup 120cm: A Frustrated 50-something Wife"s AV Debut! Yukina Miyauchi

  • yukina miyauchi censoredmature womansingle workMKDrubytsuji koujiMKD-229MKD229mkd00229
    • 2021-08-28
    42 min

    H4610 ki210829 Risa Yanagihara 21years old

  • amateur uncensoredh4610
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-10-01
    61 min

    FC2PPV 2280443 * Until 10/3 4980⇒2980 ★ Popular ☆ Virgin Brush-Down Project! That Incredible Beautiful Girl ♥ Lara Participates In The War ☆ Eating Two Amateur Virgins ♥ Thick Blowjob On The Verge Of Outburst ♥ I Can Not Stand It And I Can Not Stand

  • amateur uncensoredfc2
    • 2021-10-01
    102 min

    [SHKD-969]Shameful W Heroin Negotiations Breakdown, Servant Hot Plays - Ema Asahi, An Ayumi

  • chaoyang ema ayumi an censoredbig titsdramaSHKDattackerskinshi yoru akuSHKD-969SHKD969shkd00969
    • 2021-10-01
    131 min

    [VEO-047][Glitter] Celebrity Kyoko Machimura AV Unleashed

  • kyoko machimura censoredcreampiemature womanVEOvenuskaniebornVEO-047VEO047veo00047
    • 2021-10-02
    137 min

    [PKPT-004]Newcomer Home Sipping Documentation, Cool And Slender Newcomer Hottie, Mia Hanesaki

  • mia hasaki censoredcreampiebeautiful girlPKPTpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPT-004PKPT004pkpt00004
    • 2021-10-20
    48 min

    FC2PPV 2360859 Baseball Club Girls Who Became A Hot Topic In N ● K Manet’s No Hand Deep Throat Blow Cum 5 Barrage Swallow Girls ＃ 3

  • amateur uncensoredfc2
    • 2021-10-22
    141 min

    [ROE-014]Beautiful, Kind, Sexy, The Ideal G Cups Boss. Working At A Major Apparel Brand. Rumi Amano 47 Years Old JAV DEBUT.

  • rumi amano censoredbig titsmature womanROEmadonnamamezawa mametaroumonroeROE-014ROE014roe00014
    • 2021-10-23
    123 min

    [SRMC-037]Seductor RED vs Ayaka Mozchizuki, Cute Seductive Beast 2, Ayaka Mochizuki

  • ayaka mochizuki censoredbig titssquirtingSRMCsaimin rashrassha miyoshiSRMC-037SRMC037srmc00037
    • 2021-10-23
    244 min

    [SGKX-009]A Gal Chain Reaction Private Video Documentary (Gal-stagram #006) A Special Massive Gathering Of Nookie Gals! A Heaven-Sent Babe Of Spasmic, Orgasmic Erotic Ecstasy! Check Out Her Jiggling And Wiggling G-Cup Colossal Tits! Enjoy Splattering

  • nagi rikax censoredcreampiebig titsSGKXhame chanharii ichigal suta gramSGKX-009SGKX009h-1575sgkx00009
    • 2021-10-24
    42 min

    FC2PPV 2367786 [Limited Price] [Live Mating] Re-Appearance! ︎ A Very Popular Unequaled Model Will Go Out With 2 Consecutive Vaginal Cum Shot With Raw Sex With An Appearance! ︎

  • amateur uncensoredfc2
    • 2021-10-28
    41 min

    C0930 ki211028 Taeko Kashitani 28years old

  • amateur uncensoredc0930



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored