amateur jav cosplay nampa javcensored




FC2HNDSHKDADNWAAASSNISSISCHRVMVSDPPPDKBILULUAPODCAWDNNPJKSBJVEMAJUFEGMEMAWDATID

2020-10-28
57 min

345SIMM-540 Kokoro-chan / 18 years old / Small devil J system tossing his father

  • amateur censoredcreampieuniformsimmsimm-540simm540345simm-540
    • 2020-10-29
    69 min

    200GANA-2351 Seriously Nampa, first shot. 1547 Bringing a delicate and fair troupe member Musume to the hotel as an interview ⇒ Trying to return to a suspicious atmosphere, but if you blame the ears that it is an erogenous zone, it is easy to estrus

  • amateur censoredsquirtingamateurganagana-2351gana2351200gana-2351
    • 2020-11-12
    18 min

    FC2PPV 1567223 Limited to 2 days [Individual shooting] Prefectural Commercial Department ② Brass band club. 2 consecutive vaginal cum shot in a slender girl’s thin hair pussy

  • amateur uncensoredfc2
    • 2020-11-12
    53 min

    [NYH-055]I Can't Resist My My Friend's Big Sister's Miniskirt Panty Shot Advances, And When I Flipped Up Her Skirt And Stuck A Vibrator In, She Sweetly Taught Me All About A Woman's Body. Manami Oura

  • manami oura censoredslutNYHdirectorsdirectorsnyanjiang houseNYH-055NYH0551nyh00055
    • 2020-11-13
    145 min

    [BAHP-056]Two Sluts So Horny They Called A Guy To A Love Hotel To Fuck Them - Footage Of Sweaty Sizzling Threesome Sex

  • aya mamiya mizuki yayoi censoredblowjobBAHPbaltandaibutsu yoshidahoppinBAHP-056BAHP056bahp00056
    • 2020-11-25
    58 min

    [orec-637]うたさん

  • amateur censoredamateurblowjoborecorec-637orec637orec-637
    • 2020-12-19

    FC2PPV 1612887 This is the last [No] Newcomer sales OL, vaginal cum shot in multipurpose toilet, vaginal cum shot at hotel

  • amateur uncensoredfc2
    • 2020-12-27
    121 min

    [KSBJ-111]A Beautiful Married Woman Who Was Made To Repay Her Husband's Debt With Her Body - Natsu Nishida

  • natsu nishida censoredcreampieblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-111KSBJ111ksbj00111
    • 2021-01-01
    190 min

    [DOCP-270]Even Though Her Husband Is S******g Nearby, The Married Woman In The Futon Lusts After A Cock Other Than Her Husband's, Which She Hasn't Had In A Long Time. She Moves Close And Starts Shaking Her Hips In A Cowgirl Posture...

  • misaki reika erika ohara censoredcreampiemarried womanDOCPprestigedoc premiumDOCP-270DOCP270118docp00270
    • 2021-01-04
    48 min

    FC2PPV 1631980 ☆ First shot ☆ Complete appearance ☆ Frustrated beauty OL gave her boyfriend the first Gonzo in Naisho ♥ I shot a lot to the back of the vagina ♪ [With review benefits]

  • amateur uncensoredfc2
    • 2021-01-16
    58 min

    Caribbeancom 011621-001 Creampie SEX with Fcup gorgeous body girl Riri Shiraki

  • riri shiraki uncensoredcreampiecaribbeancom
    • 2021-02-03
    481 min

    [RVG-128]Mamasita True Tales BEST vol. 2

  • shinoda yu anne mashiro censoredmomdramaRVGglory questRVG-128RVG12813rvg00128
    • 2021-02-04
    60 min

    H0930 ki210204 Midori Yamaoka 45years old

  • amateur uncensoredh0930
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-26
    93 min

    230OREC-707 Tsukasa

  • amateur censoredbig titsmarried womanorecorec-707orec707230orec-707
    • 2021-03-06
    96 min

    [SHKD-933]An Intellectual Professor Turned Pervert And A Beautiful Literary Girl: Record Of A Sexual Desire Processing Tow - Uta Yumemite

  • yumemi teruuta censoredbeautiful girlsingle workSHKDattackersnavesharkSHKD-933SHKD933shkd00933
    • 2021-03-09
    42 min

    H0930 ki210309 Risa Naruse 38years old

  • amateur uncensoredh0930
    • 2021-03-18
    95 min

    [MESU-084]Meet An Old Lady Consultant At A Marriage Consultancy Service Who Will Have Creampie Sex With Her Male Clients So That They Gain Confidence When Looking For A Marriage Partner "I've Cum Here To Help Make You A Happy Man" Yumiko

  • yumiko sakura censoredcreampiemature womanMESUcenter villagejiro fukagawared snowMESU-084MESU084h-086mesu00084
    • 2021-03-30
    56 min

    [MNSE-012](Online Only) College Call Girl - Creampie Sex OK! Hinako - The Call Girl Who Came To Your Hotel Was Your C***dhood Friend! Beautiful Legs In Fishnet Stockings Ready To Get Spread! Hinako Mori

  • hinako mori censoredcreampieMNSEcrystal picturemaniac plusMNSE-012MNSE012mnse00012
    • 2021-04-06
    64 min

    SIRO-4479 [First shot] [Hairdresser’s egg is hidden big breasts] [For students starting a new life ..] The hairdresser’s egg who applied for a new life from spring participates in the war. Her hidden G cup breast is exposed and she fascinat

  • amateur censoredbig titsamateursirosiro-4479siro4479siro-4479
    • 2021-04-13
    51 min

    499NDH-013 Men’s esthetician who spins huge breasts like a rampage cow! Refresh your body and soul with a vaginal pressure esthetic by a plump fair-skinned erotic BODY practitioner who is comfortable to hold! !! [Is it okay to have the mask remo

  • amateur censoredbig titsamateurndhndh-013ndh013499ndh-013
    • 2021-04-15
    153 min

    [MMKZ-094]A Cute Face And A Huge Ass!! Sarina Kurokawa

  • sarina kurokawa censoredsingle workMMKZmarrionkojiro miyamotoirisMMKZ-094MMKZ094mmkz00094
    • 2021-05-14
    149 min

    [DVDMS-669]Having A Quickie With The Fair-Skinned Big-Assed Cleaning Woman! She Loved My Big Dick So Much She Came Back The Next Day For More 4

  • censoredcreampiebig titsDVDMSdeep sswing nagaseDVDMS-669DVDMS669dvdms00669
    • 2021-05-20
    125 min

    [IENF-144]You Can Clearly See Th Shape Of Their Clits! Sexy Masturbation Over Panties With Repeated Orgasms 3

  • ena koume yu tomita censoredbig titsIENFienergyienfIENF-144IENF1441ienf00144
    • 2021-05-22
    60 min

    FC2PPV 1830327 [500PT OFF] G cup idol class JD ＃ 2 Mei-chan has a nightmare of unauthorized vaginal cum shot again w (with review benefits)

  • amateur uncensoredfc2
    • 2021-05-24
    80 min

    259LUXU-1412 Luxury TV 1408 Mrs. President who appeared in AV with a beautiful body called a former race queen! The reason is that I was begged by my husband who likes NTR! ？？ Contrary to the interview where he was at a loss, in the actual production

  • amateur censoredbig titsmarried womanluxuluxu-1412luxu1412259luxu-1412
    • 2021-06-10
    43 min

    C0930 ki210610 Atsuko Kiyono 47years old

  • amateur uncensoredc0930
    • 2021-06-10
    104 min

    [SPRD-1422]My Mother-In-Law's Much Hotter Than My Wife... Yumiko Sakura

  • yumiko sakura censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1422SPRD142218sprd01422
    • 2021-06-11
    161 min

    [IPX-667]-KANZETSU- G-Spot Development! Super Wet Sex Parts Ultimate Orgasms And Fucking To The Limit! Kotomi Ono

  • kotoyumi ono censoredsquirtingblowjobIPXidea pocketbungo maedadishIPX-667IPX667ipx00667
    • 2021-06-20
    128 min

    [APNS-246]I'm Crazy About Getting G*********d By Vulgar Older Men... Hana Shirato

  • white peach censoredcreampieschoolgirlAPNSaurora project annexyukihiro nasuaurora project anexAPNS-246APNS246apns00246
    • 2021-06-25
    75 min

    [HYPN-043]Gyaru Who Makes Fun Of The Janitor Turns Into His Slut! A Whore Who Sucks Your Dirty Cock Clean With Her Mouth! Mitsuki Maya

  • aya mitsuki censoredcreampieblowjobHYPNsod createsatoshi morikawamind controlHYPN-043HYPN0431hypn00043
    • 2021-07-02
    77 min

    FC2PPV 1900268 [3480 → Limited number 2480] [BLUE highest rank ★★★] Short hair and boyish transcendental beauty ❤️ 21-year-old beauty member’s now pounding sexual circumstances ❤️ Happy and embarrassed Iku ❤️ Creampie with intense piss rich conc

  • amateur uncensoredfc2
    • 2021-07-02
    170 min

    [DVDMS-685]Ordinary Couple Hidden Camera Footage AV Masturbate And Suck Nonstop!! Amateur College Girls Try To Suck Off Countless Cocks From Gloryholes! 6 Embarrassed While Being Surrounded By Fully Erect Cocks, These Wet College Girls Fuck And Get C

  • censoredcreampieamateurDVDMSdeep sfunky hasegawaDVDMS-685DVDMS685dvdms00685
    • 2021-07-05
    62 min

    516CHIN-009 [Crossdresser] Straight boy, first crossdresser & first anal SEX

  • amateur censoredanalcreampiechinchin-009chin009516chin-009
    • 2021-07-10
    239 min

    [NASH-538]The Beautiful Hostess Who Succeeded in Attracting Customers With Her Rich Hospitality Using a Membership Plan of Having Sex With Female Customers During the Night While on Hot Spring Vacations. A Treasure Map in Western Japan.

  • censoredmature womanNASHnadeshikoNASH-538NASH538nash00538
    • 2021-07-12
    95 min

    FC2PPV 1918658 [9980 → First time limited 2980] 18-year-old super beautiful breasts beauty who knew the joy of passing away ❤️ It was said that she did it again … and she appeared completely with the power of adults ❤️ I don’t remember how

  • amateur uncensoredfc2
    • 2021-07-13
    64 min

    HEYZO 2570 Soapland Whore Gets Cream Pie On First Day of Work! – Akari Soma

  • akari soma uncensoredcreampieheyzo
    • 2021-07-15
    123 min

    [VEMA-167]Seemingly straight faced office lady Mitsumoto is a secret horny wife with big tits who doesn't mind a creampie in her pussy.

  • sayuri mitsumoto censoredcreampiebig titsVEMAvenussarumegami venusVEMA-167VEMA167vema00167
    • 2021-07-18
    68 min

    421OCN-022 Yuko-Chan

  • amateur censoredcreampieamateurocnocn-022ocn022421ocn-022
    • 2021-08-05
    42 min

    FC2PPV 1956083 1 ◯ Years Old, Meeting With An Innocent School Student, An Idol Class Student, Licking A Huge Chin In The Car In The Daytime After A Cafe, Stunned By Ejaculation

  • amateur uncensoredfc2
    • 2021-09-01
    17 min

    FC2PPV 2117863 [Personal Shooting] [Completely Original] 36-Year-Old Married Self-Defense Official ⑥ (Part 1)

  • amateur uncensoredfc2
    • 2021-09-11
    241 min

    [UMSO-414]The Y Balance Sex Of A Soft-bodied Beauty!

  • riko kitagawa ririka censoredcreampiebig titsUMSOk m produceumanamiUMSO-414UMSO414umso00414
    • 2021-10-02
    160 min

    [LULU-100]"If You Can"t Hold It In You Can Put It Inside Me!" I"m So Horny I"m About To Explode! Wife Addicted To Sex After Fucking Many Times Yuri Fukada

  • yuri fukada censoredcreampiebig titsLULUlunaticsvragmanLULU-100LULU100lulu00100
    • 2021-10-08
    65 min

    HHSI-016 Miu (Mikuru Arioka)

  • amateur censoredbig titsamateurhhsihhsi-016hhsi016hhsi-016
    • 2021-10-08
    59 min

    HEYZO 2640 Creampie in Europe #Lika – Lika

  • lika uncensoredheyzo
    • 2021-10-09
    207 min

    [MDTE-016]Raw Creampie In Sexy, Cute College Girl I Met On An Amazing App 06

  • censoredcreampieblowjobMDTEk m producetetuchuu kikakuMDTE-016MDTE016mdte00016
    • 2021-10-09
    145 min

    [ZMEN-087]When My Live-In Girlfriend Was Away On Vacation For 3 Days, I Started Having Quickie Sex With The Pretty Coworker Lady At My Part-Time Job During Our Breaks 4

  • rei hanamiya rui miura censoreduniformZMENz mennabeZMEN-087ZMEN087zmen00087
    • 2021-10-12
    48 min

    H4610 ki211012 Tomoyo Mizushima 26years old

  • amateur uncensoredh4610
    • 2021-10-14
    121 min

    [MEKO-216]"The Old Lady Rental" Service Returns 05 If You Ask This Sexy And Kind Old Lady, She"ll Secretly Let You Have Creampie Sex, And I Seriously Wanted To Fuck Her Again Like Crazy, So I Asked For Second Helpings

  • censoredcreampieamateurMEKOjukujo laboMEKO-216MEKO216h-1160meko00216
    • 2021-10-16
    140 min

    [DDHH-032]Confinement, Peeing In Her Panties In The Classroom, Mio Mashiro

  • mio mashiro censoredschoolgirldeepthroatDDHHdogmahidekiDDHH-032DDHH032ddhh00032
    • 2021-10-23
    135 min

    [AGAV-064]Best Masochism In Yokohama -Super Masochist Man"s Nipples Teased In Edging Cum Control Spider Cowgirl-

  • mio mashiro censoredbeautiful girlslutAGAVsex agentyoshida daibutsuAGAV-064AGAV064agav00064
    • 2021-10-30
    77 min

    H4610 ki211030 Himari Miyake 24years old

  • amateur uncensoredh4610
    • 2021-11-01
    123 min

    [AMBI-141]Perverted Step-Dad"s Sex Toy A Beautiful Y********l In Uniform Breaks Up With Her Boyfriend Rion Izumi

  • rion izumi censoredcreampieuniformAMBIplanet plusdirector oanbibarentsuAMBI-141AMBI141h-237ambi00141
    • 2021-11-02
    60 min

    1Pondo 110221_001 Hustle Time With A Sexy Girl : Rena

  • amateur uncensored1pondo
    • 2021-12-03
    63 min

    518ASGM-031 [Sleep Fuck / Intravaginal Ejaculation] Minato-Ku Slender JD Hidden Camera (Private Univ.) Estimated C Cup (Mahiro Ichiki)

  • amateur censoredcreampieamateurasgmasgm-031asgm031518asgm-031
    • 2021-12-09
    120 min

    [FSDSS-332]Shame Of Commanded Public Peeing Announcer. Minamo Nagase

  • minase nagase censoredbig titssquirtingFSDSSfalenoyamaguchi memberfaleno starFSDSS-332FSDSS3321fsdss00332



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored