amateur jav javcensored censored lotion oil




FC2AUKGIPXHMNHDKADTTSPRDSSISPREDMIAASQTEFSDSSHZGDDASDATIDVENUHODVHUNTBSDABSSNISAN

2020-09-04
60 min

[PARATHD-2998]Young Housewife Fucked By Her Apartment Block Janitor (2) - Beautiful D-Cup Sayaka, 27

  • censoredPARATHDparadise tvPARATHD-2998PARATHD2998parathd02998
    • 2020-09-11
    242 min

    [UMSO-340]Raw Creampie In Big Nipple Huge Tits Girl, 8 Women

  • kaho shibuya yuri chitose censoredcreampiebig titsUMSOk m produceumanamiUMSO-340UMSO34084umso00340
    • 2020-09-27
    95 min

    [VAGU-232]For My Beloved Husband... I Decided To Become A Sexual Mannequin - The Legend Of The Beautiful Mannequin Wife - Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsVAGUvenuspeterultimaVAGU-232VAGU232vagu00232
    • 2020-10-23
    240 min

    [MBM-228]How's Your Wife？! I Can't Believe Somebody Like Her Would Cheat! I've Lost Faith In Humanity... Pretty, Prim, And Proper Wives Take Stranger's Creampies Vol. 2 12 Girls, 4 Hours

  • censoredcreampieamateurMBMprestigembmMBM-228MBM228118mbm00228
    • 2020-10-23
    242 min

    [MFCC-003]MOON F***e CHEERS Sucking Collection. vol. 3

  • censoredcreampiesquirtingMFCCprestigemoon f e cheersMFCC-003MFCC003118mfcc00003
    • 2020-10-25
    138 min

    [CEAD-320]Super Perverted Mature Ladies AV Debut! First 3P X Creampie Raw Footage!! Hitomi Hitachi

  • hitachi hitomi censoredcreampiemature womanCEADceleb no tomoCEAD-320CEAD320cead00320
    • 2020-10-30
    264 min

    [KFNE-066]Club Nanpa Pickup Artists

  • censoredamateurKFNEprestigekurofune prestigeKFNE-066KFNE066118kfne00066
    • 2020-11-14
    55 min

    10musume 111420_01 Real face amateur: I made a perfect makeup for today’s shoot Yui Asakawa

  • amateur uncensored10musume
    • 2020-11-21
    52 min

    FC2PPV 1578847 [Personal shooting] Mei 20 years old ★ Creampie in missionary posture to a slender female college student of shaved bread! The last is a cleaning blow job!

  • amateur uncensoredfc2
    • 2020-11-24
    41 min

    Pacopacomama 112420_389 Minami Tanaka, Miki Horiguchi, Kanae Koizumi

  • minami tanaka miki horiguchi uncensoredfetishpacopacomama
    • 2020-11-29
    97 min

    [DBVB-033]The Hermaphrodite Sensuality Development Research Center Part 2 When The Flesh Is Awakened To The Pleasures Of Lust, They Will Break Past The Limits Of Resistance And Enter The World Of Multiple Orgasms!

  • censoredanalDBVBbabyentertainmentvenus babyDBVB-033DBVB033dbvb00033
    • 2020-12-04
    481 min

    [YMDD-216]Melody Hina Marks The Best Complete Archive: A One In 2.7 Million Beauty From Northern Europe!!!

  • melody marks censoredcreampiesingle workYMDDmomotarou eizou shuppanishikiribashi hakasejaku momoYMDD-216YMDD216ymdd00216
    • 2020-12-21
    11 min

    Caribbeancom 122120-001 Pussy Encyclopedia : Kana Takashima

  • kana takashima uncensoredcaribbeancom
    • 2020-12-24
    122 min

    [FSDSS-143]I Showed This New Masseuse My Hard Cock And She Fucked Me - Against The Rules Kaname Momojiri

  • kaname momojiri censoredbig titscosplayFSDSSfalenomachado hanyufaleno starFSDSS-143FSDSS1431fsdss00143
    • 2020-12-30
    29 min

    FC2PPV 1625621 Year-end and New Year holidays only [Individual] A young wife who does not fulfill her debt and depends on gambling, can not rely on her husband and is violated by another stick.

  • amateur uncensoredfc2
    • 2021-01-17
    104 min

    [VEC-461]All Alone With My Friend's Mother. Made To Have Secret Creampie Sex With A MILF... Kana Morisawa

  • kana morisawa kanako iioka censoredcreampiemature womanVECvenuspetermegami venusVEC-461VEC461vec00461
    • 2021-01-19

    FC2PPV 1651640 [Individual shooting 172] Saddle contact ♡ Super body with a height of 171 cm ♡ Creampie to a beautiful nurse who is a married woman and does not seem to be a mother of two children

  • amateur uncensoredfc2
    • 2021-01-30
    95 min

    [HMGL-187]PERFECT STYLE Amu Hanamiya

  • hanamiya amu censoredbig titssingle workHMGLhmjmcompany matsuoglamourHMGL-187HMGL187h-172hmgl00187
    • 2021-02-15
    49 min

    FC2PPV 1687864 [First time limited 1980] That natural beauty big breasts G cup ❤️ The size of the boobs has increased ❤️ H cup fair body ❤️ A large amount of vaginal cum shot again in a very narrow pussy ❤️ * Review privilege “Squirting challeng

  • amateur uncensoredfc2
    • 2021-02-19
    127 min

    [TIKB-101](She's Getting Her Mind Blown) A Maso Bitch Who Is Cumming Like A Perverted Cunt! She's Panting And Moaning In Ecstasy While Dribbling Pussy Juice! She's Getting Her Excessively Erotic, Meaty Ass Banged And Sapped And Fucked To

  • censoredcreampiebeautiful girlTIKBtikitiki.comerTIKB-101TIKB101tikb00101
    • 2021-03-11
    102 min

    [SPRD-1388]Forgive Me... I Want My Son-in-law's Baby - Rieko Hiraoka

  • rieko hiraoka censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1388SPRD138818sprd01388
    • 2021-03-17
    129 min

    [GVH-207]Shota-kun's Lewd Prank: I Love Asses - Ran Mukai

  • ai mukai censoredcreampiesingle workGVHglory questtorindoru tanakaGVH-207GVH20713gvh00207
    • 2021-04-08
    114 min

    [XMOM-030]Serving Wife With Milk Filled Titties Titty Fuck Party With My Masochistic Wife's Lactating Tits Hinami Narusawa

  • hinami narusawa censoredcreampiemarried womanXMOMcenter villagesky cloudspink breathXMOM-030XMOM030h-086xmom00030
    • 2021-04-16
    58 min

    230OREC-743 Mao

  • amateur censoredcreampieamateurorecorec-743orec743230orec-743
    • 2021-04-18
    156 min

    [CESD-996]We Film Everything Veteran Porn Star Yui Hatano Wants To Try

  • yui hatano censoredbig titsmature womanCESDceleb no tomoCESD-996CESD996cesd00996
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-02
    245 min

    [DONN-007]Crazy Pussy Hyper Orgasm ~

  • aya miura keiko oguchida censoredDONNbabyentertainmentcrazy babyDONN-007DONN007donn00007
    • 2021-05-07
    123 min

    [KAM-083]I Brought The Married Woman Part-Timer Home From A Work Party, And Took Hidden Camera Voyeur Footage Of Our Fucks, Then Secretly Sold It As Porn 2

  • censoredcreampiebig titsKAMkarmamanji groupKAM-083KAM083kam00083
    • 2021-05-15
    121 min

    [VENX-039]"Are You Getting Excited By Looking At My Underwear？" A Step Aunt Who Sqeezes Every Drop Of Her Step Nephew's Sperm From Her Freshly Taken Off Panties Eriko Miura

  • miura eriko censoredcreampiebig titsVENXvenusrokusaburo mishimafakecest winntersVENX-039VENX039venx00039
    • 2021-05-28
    71 min

    FC2PPV 1840783 "Most of the time! Ku * e-kun!" Part2. Beautiful legs-san de Pikone Naka ○ Shibe Ku □ Echiechi Hen 2 [Personal shooting]

  • amateur uncensoredfc2
    • 2021-06-14
    66 min

    SIRO-4556 Application Amateur, First AV Shooting 215 [First Shooting] [Sensitive Immediately Iki Nurse] [Plenty of Salvation Service] An angel in a white coat that is sure to be very popular with patients has arrived. Frustration is too sensitive, cu

  • amateur censoredamateursirosiro-4556siro4556siro-4556
    • 2021-06-20
    74 min

    300NTK-591 [Namaiki Nice Bottom Paripi GAL Ascension! !! ] Transcendental beautiful and cute gal and P activity project! !! Thighs with maximum elasticity! !! A hip that smells good! !! And Namaiki daughter in Parisi …! !! At first, I forgive my

  • galpnn censoredcreampieamateurntkntk-591ntk591300ntk-591
    • 2021-07-01

    C0930 ki210701 Yuriko Onishi 43years old

  • amateur uncensoredc0930
    • 2021-07-29
    59 min

    Pacopacomama 072921_508 This Widow is a Super Freak! Sayo Ogura

  • amateur uncensoredpacopacomama
    • 2021-07-31
    240 min

    [YMDD-238]Uhar Bitch Chapter 2 "The Woman You Want, Whenever You Want, Wherever You Want! "

  • censoredbig titsblowjobYMDDmomotaro video publishingdukeyoung peachYMDD-238YMDD238ymdd00238
    • 2021-08-10
    103 min

    261ARA-502 [Ageage Gal] [Agepoyo Max] Himari-Chan Is Here! Let’S Have Sex With Her Charming Girlfriend ♪ I Don’T Need A Detailed Reason For The Gal! Yarouze Www [Gatsuki Sex] This Is It! It’S Gal Sex ♪ Don’T Miss The Non-Stop Gree

  • amateur censoredamateuraraara-502ara502261ara-502
    • 2021-08-10
    55 min

    [081021_001]働きウーマン ～社長と密会アフター5～

  • amateur uncensored1pondo
    • 2021-08-20
    240 min

    [REXD-379]Sanctions Against The Self-Important Woman: My Dick! "Wow...It"s This Effective..."

  • censoredcreampieREXDreddogroupREXD-379REXD379rexd00379
    • 2021-08-27
    17 min

    FC2PPV 2086170 Uncensored Appearance! [Superb Egg Beauty Man Ahegao] De M Slender Beautiful Girl Manami-Chan (Personal Shooting)

  • amateur uncensoredfc2
    • 2021-09-06
    41 min

    292MY-498 Mitoma honoka 2

  • amateur censoredcreampiebig titsmymy-498my498292my-498
    • 2021-09-11
    137 min

    [DVAJ-533]While My Girlfriend Was Out Of The House On A Family Vacation For 3 Days, I Spent All That Time Fucking Her Friend, And Here Is The Video Record To Prove It Riho Fujimori (Not Her Real Name)

  • riho fujimori censoredcreampiebig titsDVAJalice japanasagiri jouDVAJ-533DVAJ533dvaj00533
    • 2021-09-24
    157 min

    [ROYD-067]My C***dhood Friend Is A Beautiful Older Woman With F-Cup Titties, And Now That I"ve Paid My Subion Fees, I Can Insert My Dick Whenever I Want, As Much As I Want! As Long As I Pay The Monthly Fees, I Can Fuck Her Anytime, Anywhere, As M

  • mikako horiuchi censoredcreampieblowjobROYDroyalmorikihhh groupROYD-067ROYD067royd00067
    • 2021-09-25
    131 min

    [LZPL-060]Tongue Heavy Lesbian Kissing Sex, Lewd Lesbian Full Body Drooling. Yumi Saeki ka, Reira Kuon

  • yuka saeki leira haduki censoredlesbianslutLZPLlez reflagmanlez re playLZPL-060LZPL060lzpl00060
    • 2021-10-08
    188 min

    [IPX-743]At the End of Abstinence, Three Days of Having Sex Like Crazy and Being Covered with Sweat and Orgasmic Juices. Momo Sakura

  • sakura sky momo censoredbig titssquirtingIPXidea pocketinnabartissueIPX-743IPX743ipx00743
    • 2021-10-23
    61 min

    HEYZO 2645 Baby-Faced Married Wife Was Cuckolded At Swimming Class – Hina Hodaka

  • hina hodaka uncensoredcreampieblowjobheyzo
    • 2021-10-24
    63 min

    413INST-177 [Fortune-Telling Nampa 3] Big Breasts Cow Boobs ♀ Big Breasts Glasses Ol & Abdominal Muscle Bakibaki Ol Muscle Man’s Seeding Pistons Raging Demon Acme! Creampie Orgy Personal Shooting Of Dirty Juice Injection (Sachiko Hachino Tsub

  • amateur censoredcreampiebig titsinstinst-177inst177413inst-177
    • 2021-10-29
    47 min

    SKHO-014 Sora (Sora Inoue)

  • amateur censoredcreampieschoolgirlskhoskho-014skho014skho-014
    • 2021-11-20
    138 min

    [CEMD-091]First Time To Have Anal Sex! Wakana Shinhaku - A Woman Who Comes In Two Holes At The Same Time With Her Soaking Wet Pussy And Dilated Anus!

  • pure white censoredanalmature womanCEMDceleb no tomoCEMD-091CEMD091cemd00091
    • 2021-12-01
    120 min

    [AMBI-144]I Want To Do It With You!! Sexy Little Sister-In-Law Continues To Provoke Brother-In-Law Mitsuki Nagisa

  • scooping censoredcreampiebeautiful girlAMBIplanet plusbito sakuraanbibaresotsuAMBI-144AMBI144h-237ambi00144
    • 2021-12-04
    140 min

    [PKPD-173]A Video Shoot Completely Without A Condom. Momo Araki

  • new princess peach censoredcreampiebeautiful girlPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-173PKPD173pkpd00173
    • 2021-12-17
    58 min

    FC2PPV 2523207 [No] Even Though It Is Delicate, F Cup Transcendent Beautiful Breasts! !! A Cool Beautiful Girl, Yuika-Chan Is Tied Up And Her Boobs Are Rubbed Violently ♥ A Powerful Seeding Press With A Cock That Has A Full Erection With Fucking! Hap

  • amateur uncensoredfc2
    • 2022-01-01
    82 min

    563PPZ-001 Paipai Zuriko. Episode 1 [K-Cup Extreme Milk Super Nova] Sakura 22 Years Old, Omurice Shop Clerk "I Had An F Cup In 5th Grade, But When I See The Elementary School Graduate Al, It’s Really Funny, Isn’t It？ Because I’m He

  • amateur censoredbig titsamateurppzppz-001ppz001563ppz-001
    • 2022-01-09
    60 min

    [010922-001]My promiscuous girl

  • rena hiiragi uncensoredcreampiehandjobcaribbeancom
    • 2022-01-15
    150 min

    [MIBB-007]Completely Clothed Athletes FUCK

  • natsuho imai nanako miyamura censoredMIBBmilususamMIBB-007MIBB007mibb00007
    • 2022-01-27
    130 min

    [STARS-489]人気エロカワ美容師めいさんは実はとんでもなくキス魔 お客様をべろちゅう誘惑ぐい 宮島めい

  • miyajima mei censoredSTARSsod createdazai chinposod starSTARS-489STARS489
    • 2022-01-29
    110 min

    [SQTE-400]This Girl Is Crazy!! A Woman That The Stuff Took As A Snack - Mina Kitano

  • mina kitano censoredbig titssquirtingSQTEs cutes cute s cuteSQTE-400SQTE400sqte00400



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored