amateur jav javcensored high vision mature woman




FC2VENXSPRDGMEMHMNDASDMILKMIAAMEYDCAWDWANZJULDTTNATRAUKGKSBJBLKSSNINACXROYDAUKS

2020-12-26
46 min

[per-357]くるみ 2

  • amateur censoredamateurblowjobperper-357per357per-357
    • 2021-01-08
    116 min

    [GUN-690]Sorry I'm So Hard - Cross-Dressing Maiden Pops Wood Arisu

  • alice censoredsingle workGUNradixshio sakurababatsugun paradoxGUN-690GUN690433gun00690
    • 2021-01-09
    129 min

    [DASD-797]Saliva And Legs Entwined. Single Night Of Raw Lust. "Tanned Young Married Woman Cheats On Her Husband" REMI

  • remi censoredbig titssingle workDASDdasrokusaburo mishimaDASD-797DASD797dasd00797
    • 2021-01-22
    240 min

    [YTR-151]Nene Takada Totally Drilled For 4 Hours

  • nene tanaka censoredcreampiebig titsYTRnonYTR-151YTR151h-127ytr00151
    • 2021-01-23
    120 min

    [CJOD-279]Sweating, Panting And Talking Dirty, My Female Coworker Made Me Fuck Her And Give Her Creampies Over And Over Again Until Morning - Hazuki Wakamiya

  • wakamiya censoredcreampiebig titsCJODchijo heavenk westCJOD-279CJOD279cjod00279
    • 2021-01-24
    126 min

    [KIMU-015]Breaking In My Naughty Stepdaughter Ichika Matsumoto

  • ichika matsumoto censoredcreampiebeautiful girlKIMUavs collector shiroyukifresh babe avs collector sKIMU-015KIMU015kimu00015
    • 2021-01-29
    240 min

    [OKAX-699]Groping A Cleaning Lady With A Tasy Ass 4 Hours

  • censoreduniformmature womanOKAXk m producedick mandokuokazuOKAX-699OKAX69984okax00699
    • 2021-01-30
    87 min

    300MAAN-621 [SSS class celebrity beauty x limit Iki barrage x vaginal cum shot 3 barrage] God erotic celebrity beauty with big breasts, nice ass, beautiful legs 3B appeared! Lick and suck while feeling! Pleasure greedy blowjob! Pursuit demon Ikase wi

  • amateur censoredcreampiebig titsmaanmaan-621maan621300maan-621
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-16
    74 min

    200GANA-2426 Seriously Nampa, first shot. 1599 Get a young and hot girl with a hot drink in Shinjuku! Former athlete’s tight body is full of pistons! Hot excitement warms various places ♪

  • amateur censoredamateurganagana-2426gana2426200gana-2426
    • 2021-02-22
    120 min

    [BLOR-164]A Super Fucked-Up G-Girl After Playing The Stripping Game, She Went Cum Crazy, Drooling And Squirting Like A Horny Bitch!

  • censoredmature womanBLORbroccoli mousouzokubroccoliBLOR-164BLOR164blor00164
    • 2021-02-26
    106 min

    504TNNN-001 Makki

  • amateur censoredbig titsamateurtnnntnnn-001tnnn001504tnnn-001
    • 2021-03-07
    78 min

    413INST-102 Hikaru Chan (19) A nurse’s egg that is sexually harassed by patients every day ♪ Abara’s slim big tits girl is skewered with a demon cock and a piston! !! The uterus cramps when you hit the waist with a rugged treatment as an on

  • amateur censoredbig titsamateurinstinst-102inst102413inst-102
    • 2021-03-13
    156 min

    [MIDE-896]They'll Still Give You Nookie Even After You Ejaculate At This Gentle And Softly Whispering Rejuvenating Massage Parlor Rikka Ono

  • rokka ono censoredcreampieblowjobMIDEmoodyzhirokoji osakimoodyz divaMIDE-896MIDE896mide00896
    • 2021-03-19
    55 min

    FC2PPV 1657605 [Personal shooting] Akira 27 years old, a large amount of vaginal cum shot to a neat and slender sensitive shaved beautiful wife

  • amateur uncensoredfc2
    • 2021-03-20
    51 min

    FC2PPV 1734396 [Individual shooting] Connected with Pocha J system of huge breasts Raw Paco Enko, very pleasant fucking and vaginal cum shot

  • amateur uncensoredfc2
    • 2021-03-26
    150 min

    [ID-010]Video Of Women Doing Dirty Things For Me On The Way To Work Rei Kuruki / Nono Yuki / Natsu Tojo

  • azuki airi sato censoredcreampiebig titsIDtmaID-010ID0105525id00010
    • 2021-04-15
    120 min

    [KSBJ-131]A Newly-married Stepniece Tempted By Her Stepuncle - Sachiko

  • sachiko censoredcreampiebig titsKSBJksb kikaku emmanuellebito sakuraKSBJ-131KSBJ131ksbj00131
    • 2021-04-15
    64 min

    200GANA-2469 In the spear room of the Nampa teacher of 100 battles, bring in SEX hidden shooting 200 Bring a nursery teacher home and havete bed IN! The whip and fair body is attractive! Hidden camera to record the foolery that can never be shown at

  • amateur censoredamateurganagana-2469gana2469200gana-2469
    • 2021-04-17
    146 min

    [CAWD-208]"I'm So Bored, I Need Some Stimulation!" Alluring College Girl With A Big Booty - Miona Kotoha - She Speaks Japanese, English, And Korean - Now This Stunning, Globe-Trotting Hottie Is Back In Japan And Ready For Her Porn Debut M

  • miona hori censoreddeepthroatsingle workCAWDkawaiimichiru arashiyamaCAWD-208CAWD208cawd00208
    • 2021-04-17
    53 min

    10musume 041721_01 Driving woman: It feels good and my driver’s seat might be soaked Akari Yuki

  • amateur uncensored10musume
    • 2021-04-21
    55 min

    492JCHA-014 The first denma is a lie

  • amateur censoreduniformschoolgirljchajcha-014jcha014492jcha-014
    • 2021-05-01
    113 min

    [AMBI-127]My Secret Love Life With My Homeroom Teacher Saya Matsui

  • saya matsui censoredcreampieschoolgirlAMBIplanet plusdirector oanbibaresotsuAMBI-127AMBI127h-237ambi00127
    • 2021-05-06
    297 min

    [AKDL-108]An Amateur Babe I Met On Thursday 3 (Faces Revealed / Sex During Office Hours / Pussy Stains / POV / She Has A Boyfriend / Superior Big Tits)

  • censoredbig titsamateurAKDLaquinoriaquinoriaknrAKDL-108AKDL1081akdl00108
    • 2021-05-14
    287 min

    [DSS-223]Picking Up Amateurs With Huge Tits! No. 223 Super Rare Platinum Body Goddess Version

  • censoredbig titsamateurDSSmomotaro video publishingdukelady huntersDSS-223DSS223dss00223
    • 2021-05-30
    62 min

    SIRO-4514 [First shot] [Super beautiful legs x Super nice ass] [Extreme standing back] A beautiful celebrity wife with outstanding style of a former race queen appears. She explodes the urge of eroticism that can not be satisfied even with saffle, an

  • amateur censoredmarried womanamateursirosiro-4514siro4514siro-4514
    • 2021-06-12
    119 min

    [AUKG-514]Denim Maniacs H

  • nagatsuki natsuki shizuka sugisaki censoredlesbianAUKGu krentoAUKG-514AUKG514aukg00514
    • 2021-06-13
    66 min

    SIRO-4547 AV application on the net → AV experience shooting 1561 [First shot] [Idol face JD] [Foot pin died] A beautiful girl college student who died with a sweet voice. She fascinates orgasms that can’t be imagined from her neat appearance.

  • amateur censoredamateurbeautiful girlsirosiro-4547siro4547siro-4547
    • 2021-06-17
    114 min

    [BKD-265]Family Fun [Continuing/Kujigawa Road] Toko Namiki

  • namiki touko censoredmature womansingle workBKDrubytobijiBKD-265BKD265bkd00265
    • 2021-07-02
    27 min

    FC2PPV 1900391 [No] [High-quality review privilege] Blue in an open-air bath with an active idol ☆ Sex during sexual intercourse ♡ First time limited 100 1600pt‼

  • amateur uncensoredfc2
    • 2021-07-10
    68 min

    C0930 tk0038 Misao Toma 29years old

  • amateur uncensoredc0930
    • 2021-07-31
    239 min

    [MLSM-049]S Class Mature Woman Best Of Reiko Kobayakawa 4 Hours Big Tits And Nice Ass Madonna

  • kobayakawa reiko censoredcreampiebig titsMLSMmellow moonMLSM-049MLSM049mlsm00049
    • 2021-08-04
    14 min

    Caribbeancom 080421-001 The Undisclosed: Hard Blowjob Till He Feels Numb Hitomi, Yumi Kamiya

  • amateur uncensoredcaribbeancom
    • 2021-08-06
    96 min

    [393OTIM-085]【妄想主観】痴女美少女と濃厚性交 水卜麻衣奈

  • amateur censoredcreampieamateurotimotim-085otim085393otim-085
    • 2021-08-12
    64 min

    515BTGL-014 Ririka (Aohitsugi Rika)

  • amateur censoredcreampieamateurbtglbtgl-014btgl014515btgl-014
    • 2021-09-18
    121 min

    [ZOCM-004]Complete POV. Plain Ordinary Married Woman With A Hot Body Has Unforgettable Time With A Guy"s Huge Dick. Colossal Tits And Huge Ass On A Submissive Sex Pet. 100cm J-cup Nanami-san Enjoys Huge Dick NTR. Nanami Matsumoto

  • nana matsumoto censoredcreampiebig titsZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-004ZOCM004zocm00004
    • 2021-09-18
    120 min

    [SYKH-032]The Abundantly Sexy, Young-Looking Middle-Aged Lady Who Has Colossal Tits And Lives Next Door: Azusa, 29 Years Old

  • censoredcreampiebig titsSYKHyuukan mrs emanielSYKH-032SYKH032sykh00032
    • 2021-09-25
    131 min

    [HMGL-188]Shy Bodies, Black Sun Yumi Saeki

  • yuka saeki censoredmature womandeepthroatHMGLhmjmcompany matsmaglamourHMGL-188HMGL188h-172hmgl00188
    • 2021-10-02
    59 min

    HEYZO 2622 Sleep With My Boyfriend! -NTR Request From My Best Friend- – Shiori Yamagishi

  • amateur uncensoredcreampiehandjobheyzo
    • 2021-11-01
    122 min

    [GOJU-190]"My Husband Won"t Look At Me As A Woman." A Wife With Colossal Tits Pleads To Appear In Porn Out Of A Desire To Still Indulge As A Woman Ms. Chiaki Age 48

  • censoredbig titsamateurGOJUisojinGOJU-190GOJU190h-1165goju00190
    • 2021-11-05
    150 min

    [URE-074]Ryou Ayumi Is Ripe For Picking! - Original Story: Minamoto - I Shouldn"t Have Deceived My Wive And Gone To That Event

  • ayumi ryo censoredcosplaymature womanUREmadonnakitorune kawaguchiure komiURE-074URE074ure00074
    • 2021-11-22
    470 min

    [STTCD-052][Bargain Set] Getting Rei Kurumi Fucked By Everyone In The Stuff - Lewd Transsexual/Compliant Transsexual

  • walnut rei censoredcreampieSTTCDtrans clubtrans club discount setSTTCD-052STTCD052sttcd00052
    • 2021-12-01
    70 min

    546EROF-009 [Leaked] K University Faculty Of Economics Miss Confinalist (21) A Vulgar Private Sex Video Of A Beautiful Girl With Outstanding Transparency! (Hana White Peach)

  • amateur censoredcreampieamateureroferof-009erof009546erof-009
    • 2021-12-04
    174 min

    [SORA-348]Kind-Faced Girl"s Release Technique Is Magnificent. Neat and Clean Office Lady With Dick Addiction Will Suck Your Balls Dry Regardless Of Place. 10 Continuous Explosive Releases. Komari Ono.

  • komari ono censoredbig titsblowjobSORAyama to sorahimurokkuSORA-348SORA348sora00348
    • 2021-12-05
    40 min

    FC2PPV 2490522 <Frustration! Ex-Wife> [Creampie For The First Time In 4 Months] <4k Shooting> Massive Secretion Of Man Juice Through Super Glossy Pantyhose (Direct Wearing) Is The Highest Ever! Nipples, Areola, Too Lascivious! Injection!!

  • amateur uncensoredfc2
    • 2021-12-13
    57 min

    481SACZ-099 Mirai

  • amateur censoredmarried womanamateursaczsacz-099sacz099481sacz-099
    • 2021-12-14
    128 min

    [KTRA-355]Record Of My Niece And Uncle "Riina" Riina Asuka

  • rina asuka censoredcreampiebig titsKTRAk tribeKTRA-355KTRA355
    • 2021-12-17
    150 min

    [BLK-543]Slutty gal who will come to the club if you call her and have sex with you!

  • censoredcreampiebig titsBLKkira kirakira kira black galBLK-543BLK543blk00543
    • 2022-01-04
    19 min

    10musume 010422_01 Secret Pussy Collection: Akari Kato

  • amateur uncensored10musume
    • 2022-01-04
    53 min

    FC2PPV 2567746 "Please Put In" Manager Of The Track And Field Club Of A Famous University [Completion Of The First Shooting Supplement Plan] Inserting A Big Cock In A Pussy With Outstanding Sensitivity, Panting While Panting In A Soaked State

  • amateur uncensoredfc2
    • 2022-01-14
    79 min

    529STCV-051 [Neat And Clean Bitch Who Seduces Classmate Boys With Fluffy H Cup Milk] Jun-Chan And Jun-Chan Of The Table Tennis Club Who Ate All The Boys Of The Same Club Activities! A Genuine Bitch That Is Called "Always A Vagina" At School!

  • amateur censoredcreampiebig titsstcvstcv-051stcv051529stcv-051
    • 2022-01-15
    164 min

    [FLAV-288]S********l With Hard Nipples And A Big Ass Becomes A Sex Toy To Satisfy Us. Lewd S********l Has The Face Of An Idol And Nipples That Stick Out When They Get Hard, Her Cute Face Comes With A Curvy Lower Body And Womanly Big Ass That Lures Us

  • censoredschoolgirlslutFLAVdigital arkkashimadigital ark dejitarua kuFLAV-288FLAV288flav00288
    • 2022-01-24
    102 min

    300MIUM-784 [Creampie Super Rich 2 Barrage! !! !! ] The Unbelievable Akita Beauty Came To Spear With Frustration! The Wife Who Likes Outdoor Play Brings The Shooting Team To The Emergency Stairs Without People And Immediately Enjoys The Big Dick! [Sn

  • amateur censoredcreampiemarried womanmiummium-784mium784300mium-784
    • 2022-02-03
    195 min

    [ABW-198]120肯定カノジョ VOL.03 優し過ぎる恋人れむと、超絶倫で超早漏な僕の射精しまくり同棲性活 涼森れむ

  • amateur censoredbig titsamateurabwabw-198abw198abw-198
    • 2022-02-12
    110 min

    [SYKH-043]"Standing Wife" B-class Mature Woman - Chiaki, 46 Years Old

  • censoredcreampieamateurSYKHleisurely missus emmanuelleSYKH-043SYKH043sykh00043
    • 2022-03-10
    121 min

    [HBAD-613]Beautiful Female Teacher Held Down And Fucked Hard With Wild Cock Plunging Into Her Neat Clean Pussy Hole Sending Her Into Ecstasy. Riona Hirose.

  • rio hirose censoredsingle workHBADhibinonamitaro umababeHBAD-613HBAD6131hbad00613



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored