asai




FC2ONEZMVSDHUNTBVEMANACRWAAAFSDSSHDKASHKDSPRDAPODIPXPREDHMNMIAAWANZNACXGMEMAVSACHRV

2020-11-24
98 min

[NUBI-045](Groper Theater) College Girl Gets Horny For The Guys Feeling Her Up (Breaking In With Exhibitionist Sex)

  • censoredcreampieNUBIkalimantannubiaNUBI-045NUBI045h-1112nubi00045
    • 2020-12-01
    138 min

    [SDJS-098]SOD Female Employees - Brand New Hire From The South Got Her Start At A Soapland Brothel! And Masturbation Club! And Bikini Massage Parlor! A Call Girl, Too! Enjoy Superb Service At The Hands Of A SK**led Slut In This Deluxe 5-Course Indulg

  • miyazaki rin censoredbeautiful girlsingle workSDJSsod creategoemonsod female employeeSDJS-098SDJS0981sdjs00098
    • 2020-12-05
    119 min

    [SSNI-938]Ecstasy! First Experiences - Slim, Tall Girl Has Three Incredible Fucks - Multiple Orgasm Special Kanon Tsukishima

  • tsukishima kanon censoredbeautiful girlsingle workSSNIs1 no 1 stylezaku araiSSNI-938SSNI938ssni00938
    • 2020-12-10
    240 min

    [HBAD-567]She's Using Her Fully Ripe Big Tits And Super Limber Limbs To Mesmerize My Cock And Take Care Of My Lust

  • marina yuzuki aya takashiro censoredbig titsblowjobHBADhibinobabeHBAD-567HBAD5671hbad00567
    • 2020-12-16
    45 min

    FC2PPV 1608572 [Personal shooting / set sale] 29-year-old married woman who has fallen into customs ① ・ ②

  • amateur uncensoredfc2
    • 2020-12-20
    152 min

    [HND-927]Smart College Girl Completely Converted To Team Slut After Her First Creampie Natsu Tojo

  • natsu tojo censoredcreampieblowjobHNDhon nakausa pyonHND-927HND927hnd00927
    • 2020-12-25
    78 min

    259LUXU-1359 Luxury TV 1344 A boxed girl who has been carefully raised by her parents makes an AV appearance! Ascend to outstanding foreplay while flushing her clear white skin and slender body! Taste the penis deliciously while wetting the secret pl

  • amateur censoredamateurluxuluxu-1359luxu1359259luxu-1359
    • 2020-12-30
    59 min

    Pacopacomama 123020_407 Keiko Imamiya

  • keiko imamiya uncensoredcreampieblowjobpacopacomama
    • 2021-01-09
    119 min

    [MEYD-645]I Finally Got My First Girlfriend... When The Naughty Married Woman Next Door Seduced Me Sakura Misaki

  • cape sakura censoredcreampieslutMEYDtameike gororyo inugamiMEYD-645MEYD645meyd00645
    • 2021-01-20
    42 min

    FC2PPV 1652394 [No] [Limited to 100 pieces 1000pt OFF!] 2 consecutive vaginal cum shots for active idols ♥ ️ Shortcut slender loli beautiful girl ♥ ️ Complete appearance raw vaginal cum shot sex lifted! ♥ ️ * Review benefits / Gokkun Blow while elect

  • amateur uncensoredfc2
    • 2021-01-22
    118 min

    [HZGD-175]I Started To Lust For My Colleague's Wife, And When I Could No Longer Resist, And Grabbed Her Tight, She Lusted For Me Too And Placed Me Under Confinement And Fucked My Brains Out As She Pleased ... . Yuria Satomi

  • satomi yuria censoredcreampiebig titsHZGDmarried woman flower garden theaterzampaimage married woman flower garden theatHZGD-175HZGD175h-1100hzgd00175
    • 2021-01-23
    160 min

    [GS-2003]Total Adultery #2 Married Woman Hot Water Love Trip 114, 115 - Continued

  • censoredGSgosGS-2003GS2003h-101gs02003
    • 2021-01-29
    16 min

    FC2PPV 1664594 Until the 1st 1480pt → 1180pt [Personal shooting] I put it in my stomach to a slender young wife who feels at the woman on top posture.

  • amateur uncensoredfc2
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-15
    57 min

    345SIMM-607 A cute and transparent girl is having sex with her sister’s boyfriend all day long! Pregnancy confirmed with a total of 3 thick Yui mass vaginal cum shot! ？？ “I’m having sex with myself every day” “(Even if my sis

  • amateur censoredcreampieamateursimmsimm-607simm607345simm-607
    • 2021-02-16
    63 min

    FC2PPV 1689070 ★ First shot amateur ☆ Large screaming ♥ Muramura lust BODY ♥ Local active OL Tsubaki-chan 25 years old ☆ Glossy erotic BODY ♥ Sensitive electric maiki ♥ Rich raw squirrel screaming screaming cum shot sex ♥ [Personal shooting] * With b

  • amateur uncensoredfc2
    • 2021-02-22
    118 min

    [BHG-038]They're So Big! An H-Cup Titty Cosplayer I Want To Fuck Yume Natsuki

  • natsuki yume censoredcreampiebig titsBHGgain corporationBHG-038BHG038bhg00038
    • 2021-03-06
    44 min

    FC2PPV 1714556 [Individual shooting] I couldn’t stand the raw Paco erotic body of my super cute niece and I made a vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-03-18
    218 min

    [HUNTA-976]There's This Latchkey Girl Who I Often See Around My Apartment Complex, And I Realized That She Was Lonely, So When I Treated Her Nicely, She Came Over To My Place, And Didn't Refuse To Have Sex, So She Gave Me A Blowjob, And We Ha

  • censoredcreampieuniformHUNTAhunterkawajirihhh groupHUNTA-976HUNTA976hunta00976
    • 2021-03-25
    60 min

    Caribbeancom 032521-001 Quick Shooting: The Best of Mika Aoki

  • mika aoki uncensoredcreampiecaribbeancom
    • 2021-03-27
    51 min

    C0930 ki210328 Tamami Sugioka 22years old

  • amateur uncensoredc0930
    • 2021-03-31
    31 min

    FC2PPV 1748293 There is a "no" review privilege. A large amount of facial cumshots & raw squirrels on a cute gal though it looks like a sadism

  • amateur uncensoredfc2
    • 2021-04-02
    158 min

    [HUNBL-040]Long-Distance Shame She Got A Remote-Controlled Vibrator Plunged Into Her Pussy, And Now She's Trying Desperately Not To Cum While Working, As Her Cunt Begins To Drip And Dribble

  • censoredcreampieHUNBLhuntergeminihhh groupHUNBL-040HUNBL040hunbl00040
    • 2021-04-14
    64 min

    FC2PPV 1770132 [Actual condition of sperm donation] Department store receptionist wife 25 years old [Sweet beautiful voice] SNS ＃ Married woman who came by sperm donation vaginal cum shot! Head bug in the first cock uterus kiss Ahegao convulsions Acm

  • amateur uncensoredfc2
    • 2021-04-15
    138 min

    [BDA-138]Brainwashing Undercover Investigation - Honoka Tsujii

  • tsujii honoka censoredbig titsbdsmBDAbermuda mousouzokuichikan abashiriBDA-138BDA138bda00138
    • 2021-04-18
    302 min

    [XRL-001]Making Women With Big And Beautiful Tits Cum: 10 People, 300 Minutes

  • censoredcreampiebig titsXRLreal worksdokujireal real worksXRL-001XRL001xrl00001
    • 2021-04-30
    59 min

    C0930 ki210502 Misato Uemoto 21years old

  • amateur uncensoredc0930
    • 2021-05-02
    46 min

    188HINT-0453 Chiaki

  • amateur censoredmarried womansquirtinghinthint-0453hint0453188hint-0453
    • 2021-05-10
    81 min

    259LUXU-1418 Luxury TV 1402 An announcer with a fascinating sweet voice has arrived! Contrary to the cute looks of adults, lonely days without professional encounters … Inevitably, the body that became greedy for the warmth and stimulation of th

  • amateur censoredamateurluxuluxu-1418luxu1418259luxu-1418
    • 2021-06-04
    44 min

    FC2PPV 1850801 <Personal shooting> Bento shop PART3 <Married woman / Mature woman Gonzo>

  • amateur uncensoredfc2
    • 2021-06-16
    239 min

    [HUNTB-033]"What If I Touched It To Get You Used To It？" I Pop Wood At Anything These Days And It's So Embarrassing... My (Private Tutor, Stepsister, C***dhood Friend) Offered To Help Me Train My Erection...

  • censoredcreampieblowjobHUNTBhuntermorikihhh groupHUNTB-033HUNTB033huntb00033
    • 2021-06-17
    121 min

    [BST-023]Travel Agency Sales Manager I Had Business Sex With A Virgin! Nanao Nakano

  • censoredamateurbeautiful girlBSTrubyboston bagBST-023BST023118bst00023
    • 2021-06-20
    128 min

    [APNS-246]I'm Crazy About Getting G*********d By Vulgar Older Men... Hana Shirato

  • white peach censoredcreampieschoolgirlAPNSaurora project annexyukihiro nasuaurora project anexAPNS-246APNS246apns00246
    • 2021-06-20
    119 min

    [OFKU-183]Huge Ass Step-Mom Comes To Tokyo From From Ishikawa Aki Misato Age 50

  • aki misato censoredmature womanmomOFKUstar paradisemom railOFKU-183OFKU183h-254ofku00183
    • 2021-06-25
    171 min

    [DOMI-001]A Life in Adoration of a Giant Female. Chitose Yuki.

  • chitose in the evening censoredbig titssingle workDOMImaguro honpokoubunridoronikuatsu shihaiDOMI-001DOMI001h-1441domi00001
    • 2021-07-06
    46 min

    188HINT-0466 Yuki

  • amateur censoredcreampiesquirtinghinthint-0466hint0466188hint-0466
    • 2021-07-13
    140 min

    [STARS-416]Flexible Ballerina Fucked With Huge Dick - 3 films. Anna [High-quality 4K images!]

  • anna censoredbeautiful girlsingle workSTARSsod createsuisei akaisod starSTARS-416STARS4161stars00416
    • 2021-07-17
    75 min

    355OPCYN-170 Rin Miyazaki Rin

  • amateur censoredcreampiemarried womanopcynopcyn-170opcyn170355opcyn-170
    • 2021-07-30
    151 min

    [SSIS-142]The Pleasure Of Jun Kosui, A Frank, Fair Skinned Beautiful Girl! Everything Is Her First Experience And She Comes Hard 3

  • kosui jun censoreduniformbeautiful girlSSISs1 no 1 stylearashiyama michiruSSIS-142SSIS142ssis00142
    • 2021-08-13
    141 min

    [BLK-512]Sudden Reverse Pick Up Harem Wagon! If You"re Going To Have Sex With Dull Women, Better Fuck With Us!! Nene Tanaka, Ruka Inaba

  • nene tanaka inaba censoredcreampieslutBLKkira kirasamoarikira hosi kira black galBLK-512BLK512blk00512
    • 2021-08-14
    99 min

    300MAAN-685 [Do M Make Her Cuckold And Fuck] Super Obedient De M Constitution That Makes You Feel Ordered! !! Sex In The Brush Down Raw That The Movement Of The Waist Does Not Stop At The Virgin Ji ○ Port Of Gatchigachi! !! → Horse Riding Blowjob &am

  • amateur censoredcreampieamateurmaanmaan-685maan685300maan-685
    • 2021-09-04
    118 min

    [AUKG-520]From Widow To Lesbian: Her Mourning Dress Arouses Her Sister-In-Law, Starring Risa Dan and Miyuki Fuji

  • rinsha dan miyuki fuji censoredbig titslesbianAUKGu krentoAUKG-520AUKG520aukg00520
    • 2021-09-11
    119 min

    [LUNS-080]60 Something Doggy Style 11

  • censoredcreampiemature womanLUNSluna shunkoushaLUNS-080LUNS080luns00080
    • 2021-09-24
    239 min

    [YTR-156]Nene Tanaka, Totally - 4 Hours Of Non-stop Fucking

  • nene tanaka censoredcreampiebig titsYTRnonYTR-156YTR156h-127ytr00156
    • 2021-09-27
    97 min

    FC2PPV 2257439 I Tried To Play Metamorphosis To The Weather Girl Class Tsun Tsun Girls

  • amateur uncensoredfc2
    • 2021-09-30
    16 min

    HEYZO 2621 Natsumi’s Amazing Hand Job – Natsumi Hirose

  • natsumi hirose uncensoredhandjobheyzo
    • 2021-10-06
    49 min

    541AKYB-010 Hitomi (28) Nasty, De M G Cup Sister ♪

  • amateur censoredanalbig titsakybakyb-010akyb010541akyb-010
    • 2021-10-27
    94 min

    348NTR-036 <Good News> All Women Can Be Defeated By Pleasure And Guarantee. Discover A Couple Flirting Near The Amusement Park In Tokyo Domu! She Has A Hard Guard As She Looks, And Even After A Few Hours Of Persuasion, Negotiations Fail. However,

  • amateur censoredcreampiebig titsntrntr-036ntr036348ntr-036
    • 2021-11-23
    134 min

    241GAREA-528 Rikochi (Tsukushi Mika)

  • amateur censoredamateurbeautiful girlgareagarea-528garea528241garea-528
    • 2021-12-03
    150 min

    [WAAA-126]This Beautiful Girl Was Held In Confinement In This Decrepit Home By A Horny, Dirty Old Man And Impregnated With Semen Bukkake And Soiled To Her Soul While She Came With Pleasure ... Meisa Kawakita

  • kawakita meisa censoredcreampiebig titsWAAAones factorywanzWAAA-126WAAA126waaa00126
    • 2021-12-04
    310 min

    [HOIZ-032]Cum Cum Cute #03 Amateur Cum Cum Z / Beautiful Girl / Amateur / Private Video Session / Hookup App / POV / SNS / Cum Face / 2 Ejaculations / Neat And Clean / Beautiful Tits / Big Tits / Slender / Black Hair

  • censoredbig titsamateurHOIZamateur seduction daydream familyHOIZ-032HOIZ032hoiz00032
    • 2021-12-10
    170 min

    [BANK-064]Creampie At The Open-air Hot Springs Bath. Slim And Busty With A Super Narrow Waist! Pink Areola And Pink Nipples On This Lewd Slut With A Snake-like tongue.

  • censoredcreampiebig titsBANKma ko ginkoutakechanBANK-064BANK064h-1495bank00064
    • 2021-12-16
    485 min

    [ABBA-545]All You Can Seed! All You Can Do! Convenient Nakadashi Meat Masturbator Is My Friend"s Mother 30 People 8 Hours 2 Discs

  • censoredcreampiemarried womanABBAcenter villageABBA-545ABBA545h-086abba00545
    • 2021-12-17
    161 min

    [MIDV-020]In The Countryside Where Her Husband Was Transferred... Bored And Bored, She Seduced A Man In The Neighborhood, Straddled Him Without Permission, And Kept Swinging Her Hips... Fumika Nakayama

  • nakayama fumika censoredbig titsslutMIDVmoodyztrendy yamaguchimoodyz divaMIDV-020MIDV020midv00020
    • 2022-01-10
    90 min

    300MIUM-786 Go On A Pheromone Ol And A Sabotage Trip With A Godly Balance Of Flesh And Constriction! I Thought He Was A Solid Common Sense Person … It’s A Super Carnivorous System ● This Is Hot And Ready At Any Time Www I’m Completely

  • amateur censoredcreampiebig titsmiummium-786mium786300mium-786
    • 2022-01-10
    63 min

    422ION-0093 Gonzo Out Flirting At The Hotel With Her Best Friend Girlfriend (Nanami Yokomiya)

  • amateur censoredamateurbeautiful girlionion-0093ion0093422ion-0093



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored