ass fetish jav high vision sister javcensored




FC2JULHODVAPODROYDHUNTBFSDSSKSBJKBISQTESHKDVEMAADNMARAHMNMILKMIDVAWDNATRMIAASAN

2020-06-06
175 min

[HUNTA-785]My Little Stepsister Was Wearing A Knitted One Piece Dress And Knee-High Socks, And Thrusting Out Her Ass, And I Could No Longer Resist, So I Plunged My Cock Into Her And After Creampie Fucking Her, Over And Over...!？ 2 Once She Became A C

  • censoredcreampiesisterHUNTAhuntercognac kaminohhh groupHUNTA-785HUNTA785hunta00785
    • 2020-05-31
    137 min

    [MMKZ-078]This Elder Sister Type With A Big Ass Is Too Filthy And Will Blow Your Mind In Seconds!! Kokoa Aisu

  • aisu shinya censoredsingle workMMKZmarrionkojiro miyamotoirisMMKZ-078MMKZ078mmkz00078
    • 2020-05-29
    240 min

    [OKAX-621]Lusting For The Working Office Lady's Thick Thighs 4 Hours

  • censoreduniformOKAXk m producedick mandokuokazuOKAX-621OKAX62184okax00621
    • 2020-05-27
    137 min

    [GAID-002]A Fairy Tail 3 A Former Gravure model Who Looks Good In A Super Short Miniskirt And Polo Shirt Renka Yamamoto

  • yamamoto renka censoredcreampiesquirtingGAIDfirst starbirdman teppeiaida first starGAID-002GAID002h-491gaid00002
    • 2020-05-17
    121 min

    [MKON-029]My Big Sister Let My Classmate Touch Her Thighs, And It's All My Fault Kanae Kawahara

  • kanae kawahara censoredcreampiesisterMKONkaguyahimept mousouzokunortonmikonMKON-029MKON029mkon00029
    • 2020-05-02
    203 min

    [GDHH-198]"You're The Only One, Big Stepbrother, Who Thinks My Ass Is Nice." My Little Stepsister Has An Inferiority Complex About Her Excessively Big Ass... When She Became A S********l, Her Ass Continued To Grow And Grow...

  • censoredcreampiesisterGDHHgolden timekorosukehhh groupGDHH-198GDHH198gdhh00198
    • 2020-05-01
    301 min

    [DKSB-051]Filthy Sexual Harrasment Chiropractic Clinic Only Targets Beautiful Married Women 5 Hours

  • censoredbig titsamateurDKSBoffice k sno directork s bestDKSB-051DKSB05136dksb00051
    • 2020-05-01
    144 min

    [DOKS-518]Thick And Super Steamy! Fleshy Pantyhose Kanna Shinozaki

  • kina shinozaki censoredsingle workDOKSoffice k sgonzaburo onigawaraDOKS-518DOKS51836doks00518
    • 2020-04-28
    164 min

    [EQ-515]Will You Squeeze My Big Tits？ Picking Up Local Amateurs With Big Tits!

  • censoredcreampiebig titsEQbullittrocket taropretty honey brittEQ-515EQ515h-100eq00515
    • 2020-04-15
    239 min

    [PYM-336]She Mounts It For A Cowgirl Piston Fuck - Squeezing Dildo Masturbation

  • censoredPYMprimoPYM-336PYM336h-283pym00336
    • 2020-04-10
    120 min

    [VRTM-494]"It's Been A Long Time Hasn't It..." Hiding Under The Bed Covers With That C***dhood Friend You Used To Flirt With - Hot And Sweaty SEX Licking Each Other All Over, Holding Each Other Tight While Fucking And Giving Her A Cre

  • mitani akari hasumi claire censoredcreampieVRTMv r producegoro koenjiVRTM-494VRTM494h-910vrtm00494
    • 2020-04-04
    156 min

    [PRED-226]I Shared A Room With My Sexy Female Coworkers On The Last Day Of Our Business Trip (Japanese Inn) These Two Sluts Joined F***es To Fuck Me Hard...

  • aika yamagishi kana mito censoredcreampiePREDpremiumsapporo taroelegancePRED-226PRED226pred00226
    • 2020-03-28
    151 min

    [MIAA-249]My 2 Females Bosses Apologize For My Mistake - They Get Down On Their Knees And Get Fucked From Behind By An Angry Old Man - Elly Akira, Maria Nagai

  • aki erie arai erie yuka osawa maria nagai censoredcreampieMIAAmoody sham the mckikatan for everyoneMIAA-249MIAA249miaa00249
    • 2020-03-27
    158 min

    [XRW-854]Good Women's Erotic Drama Masterpiece Selection: Enjoy Beautiful Asses And Ecstasy In This Drama: Japanese And Western Asses To Your Heart's Content: Hikari Sakuraba, Wakana Shiroyama, Asuka Takagi, Rina Otomi

  • sakuraba hikari shiroyama wakana censoredcreampiebig titsXRWreal workshideki hormonreal real worksXRW-854XRW854172xrw00854
    • 2020-03-13
    120 min

    [VRTM-488]"I'm Not Gonna Let You Cum!" - A Private Tutor In Knee Socks Does Cum Control On Her Cherry Boy S*****t! - She Makes Him Save It Up Until He's Ready To Explode, Then Finally Lets Him Cum Inside Her!

  • manami oura miho tsuno censoredslutVRTMv r producegoro koenjiVRTM-488VRTM488h-910vrtm00488
    • 2020-02-20
    46 min

    [HHKL-009]My Stepsister Is Completely Defenseless With Her Super Beautiful Ass On Show, And She Let Me Fuck Her And Creampie Her From Behind! I Couldn't Help It! The Temptation Was Too Strong! - Misaki-chan

  • misaki chan censoredschoolgirlsisterHHKLhuntermorikihhh groupHHKL-009HHKL009hhkl00009
    • 2020-02-14
    122 min

    [VRTM-481]Sister Brainwashed And Turned Into Stepdad's Toys... 2

  • yui nagase toua kotone censoredcreampiesisterVRTMv r produceolive yoshidaVRTM-481VRTM481h-910vrtm00481
    • 2020-01-17
    149 min

    [ZMEN-039]I Accidentally Had A Quickie With My Girlfriend's Younger Sister Instead Of Her! I Only Realized When I Was In The Middle Of Giving Her A Creampie!! 4

  • censoredcreampieblowjobZMENz menkaoruZMEN-039ZMEN039h-1371zmen00039
    • 2020-01-17
    163 min

    [MMKZ-070]My Older Sister's Huge Ass Is So Sexy I Can't Control Myself! Airi Takasaka

  • airi takasaka censoredsingle workMMKZmarrionkojiro miyamotoirisMMKZ-070MMKZ070mmkz00070
    • 2020-01-16
    222 min

    [HUNTA-709]I'm Getting Knocked Out By That Tight Little Ass She's Thrusting At Me!! My Little Sister-In-Law Has A Super Beautiful Ass And A Godly Ass And I Creampie Fucked Her Over And Over Again!! I Suddenly Got A New Little Sister-In-Law, A

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-709HUNTA709hunta00709
    • 2020-01-15
    240 min

    [PYM-326]Cock-Mounting Cum-Crazy Piston-Pounding Dildo Masturbation

  • censoredPYMprimoPYM-326PYM326h-283pym00326
    • 2019-12-13
    119 min

    [VRTM-471]This Kind And Gentle Big Ass Big Stepsister Was Wearing A Tight Skirt And Exerted Her Total Domain Over A Horny Little Stepbrother! When She Was Given Aphrodisiacs, She Started To Rub Her Knee-High Socks Against Him And Dripped Juicy Stains

  • nanako miyamura ririka censoredcreampiesisterVRTMv r producegoro koenjiVRTM-471VRTM471h-910vrtm00471
    • 2019-11-30
    164 min

    [AP-720]Housekeepers With Huge Asses - Touching Maids In Tight Pants

  • censoredAPapachegeronimohhh groupAP-720AP720ap00720
    • 2019-11-24
    117 min

    [AUKG-472]HIP HIP LESBIAN

  • sumire kurokawa blue censoredlesbianAUKGu krentoAUKG-472AUKG472aukg00472
    • 2019-11-21
    121 min

    [SW-669]Chubby Asses In Black Pantyhose Rub Against Horny Students' Cocks On A Crowded Bus! These Ladies Are So Excited By The Hard Young Cocks That Just Grabbing A Handful Isn't Enough, And They Let Themselves Get Fucked Right In Front Of Th

  • censoredSWswitchtakeshi yamashiroswitch switchSW-669SW6691sw00669
    • 2019-11-14
    195 min

    [HUNTA-680]The Rumor About This Girl With A Bulging Ass Who Shows Up At A Convenience Store Late At Night Is That She's Super Horny She's Prancing Around With Her Ass Bulging Out! Is She Doing It On Purpose？ I'm Working Part-Time At A Con

  • censoredHUNTAhunterkoichi davidsonhhh groupHUNTA-680HUNTA680hunta00680
    • 2019-10-04
    160 min

    [DVDMS-454]A Normal Boys And Girls Documentary Adult Video This Big Ass Big Stepsister Is Hunting For A Job, And The Only Way She Can Relieve Her Stress Is To Have Creampie Sex With Her Little Stepbrother (But It's A Secret)

  • censoredcreampieamateurDVDMSdeep sjohan yuanDVDMS-454DVDMS454dvdms00454
    • 2019-09-26
    159 min

    [SW-655]My Stepsister And Her Friends Are Devilish Little Sluts! They Came Over To My House And Lured Me To Miniskirt Panty Shot Temptation, And While My Little Stepsister Was Looking The Other Way, I Shoved My Big Orgasmic Cock Into Their Pussies An

  • censoredslutsisterSWswitchyocchanswitch switchSW-655SW6551sw00655
    • 2019-09-13
    121 min

    [VRTM-453]This Little Brother-In-Law Is Lusting For His Kind And Gentle Big Ass Big Sister-In-Law Who Wears A Tight Skirt! When He Gave Her Aphrodisiacs To Drink She Started Rubbing Her Knee-High Socks Up Against Him And Staining Her Panties, And The

  • otsuki sound yuki sakuragi censoredcreampiesisterVRTMv r producerokutanzo no seishiVRTM-453VRTM453h-910vrtm00453
    • 2019-09-09
    241 min

    [KTFT-002]My Wife's Slippery Interview

  • censoredbig titslingerieKTFTkahanshin tigers mousouzokuurajixthe kahanshin tigersKTFT-002KTFT002ktft00002
    • 2019-08-22
    105 min

    [GS-279]This Elder Sister Is Looking Sexy With Her Pantyhose Ripped While She Walks Down The Hallway!! I Was Always Interested In This Hot-Looking Elder Sister, And Now I See That Her Pantyhose Is Ripped! When I Told Her About It, She Asked, "Whi

  • censorednurseGSsosoru x garconkinton kuriGS-279GS2791gs00279
    • 2019-08-09
    131 min

    [VRTM-444]We Gave Aphrodisiacs And Sleeping Pills To A Cabin Attendant With A Big Ass In Black Pantyhose! Then We Tied Her Up While She Was Sleeping And Assaulted Her With A Vibrator! Once She's Fully Aroused, She Gets Fucked Hard Until Her Knees

  • otsuki sound yuki sakuragi censoreduniformsisterVRTMv r producegoro koenjiVRTM-444VRTM444h-910vrtm00444
    • 2019-08-04
    159 min

    [DIGI-240]HYPER HIGHLEG QUEEN Moe Kurashina

  • moe kurashina censoredslutsingle workDIGIdigital arkdigital ark digital arkDIGI-240DIGI240digi00240
    • 2019-08-03
    177 min

    [GDHH-162]Vertical Criss-Crossing Piston Cowgirl Sex For A Continuous 3 Consecutive Creampie Fuck!! My Big Sister-In-Law Has Recently Started That Beauty Ass Training That's All The Rage Nowadays, And She Was Wearing Tights And Thrusting Out Her

  • censoredcreampiesisterGDHHgolden timegorilla butahhh groupGDHH-162GDHH162gdhh00162
    • 2019-08-03
    120 min

    [PRED-172]An Elegant Saleswoman Seduces You With Her Surprisingly Slutty Thongs - Aika Yamagishi

  • aika yamagishi censoredslutlingeriePREDpremiumsapporo taroelegancePRED-172PRED172pred00172
    • 2019-07-26
    44 min

    [WKD-019]A Woman In Full Bloom Ann Sakura

  • sakura an censoredslutsingle workWKDwaap entertainmentk westwWKD-019WKD0192wkd00019
    • 2019-07-12
    120 min

    [ZMEN-020]I Accidentally Had A Quickie With My Girlfriend's Younger Sister Instead Of Her! I Only Realized When I Was In The Middle Of Giving Her A Creampie!! 2

  • censoredcreampieblowjobZMENz mennaveZMEN-020ZMEN020h-1371zmen00020
    • 2019-07-05
    235 min

    [DOCP-157]Sexy First Rate Ass Twerking And Cowgirl Sex To Fill A Friend's Older Sister With Endless Loads Of Cum Until There's None Left vol. 2

  • ai minano kurata mao censoredcreampieDOCPprestigedoc premiumDOCP-157DOCP157118docp00157
    • 2019-07-04
    146 min

    [GDHH-157]"H, Hey, What Are You Doing!？" My Big Sister-In-Law Has Such A Godly Ass, I Tied Up Her Hands And Legs And Inserted My Cock, Instantly! When Our Parents Got Remarried, I Got A New Big Sister-In-Law With An Ultra Godly Ass! I Was Sec

  • censoredcreampiesisterGDHHgolden timekiteretsuhhh groupGDHH-157GDHH157gdhh00157
    • 2019-06-15
    232 min

    [HUNTA-611]Mesmerized By Her Bubble Butt!! I Creampied My Stepsister With A Super Beautiful Ass, No, A Godly Ass, Doggy-Style, Over And Over Again!! 2. I Suddenly Have A Cute Stepsister With A Super Beautiful Ass!! She's Careless So I Keep Seeing

  • censoredcreampiesisterHUNTAhuntermorikihhh groupHUNTA-611HUNTA611hunta00611
    • 2019-06-15
    161 min

    [OYC-260]Hot Housekeeper Crawling Huge Ass Molestation, She Gives Up To The Feeling When She Gets Slammed Over And Over From Behind

  • censoredOYCoyashoku.companydozuruhhh groupOYC-260OYC260oyc00260
    • 2019-06-15
    170 min

    [HUNTA-613]"Please Let Me Go! You're Going To Break Me!!" I Couldn't Control Myself Because My Stepsister Is So Careless. I Hold Her Ankles Down And Continuously Creampie Her From Behind Until She Has Convulsive, Intense Orgasms And T

  • censoredcreampiesisterHUNTAhuntercognac kaminohhh groupHUNTA-613HUNTA613hunta00613
    • 2019-06-07
    215 min

    [DOCP-152]Sassy HS Sister's Jiggly Butt Temptation

  • nanaho kase aori arisei censoredschoolgirlsisterDOCPprestigedoc premiumDOCP-152DOCP152118docp00152
    • 2019-06-03
    64 min

    [KWP-002]Her Sexy Ass In 20-Denier See-Through Pantyhose Mao Hamasaki

  • hamazaki mao censoredsingle workKWPk westk westpsKWP-002KWP002h-1339kwp00002
    • 2019-05-25
    150 min

    [MIAA-084]"Hey, Will You Come To My Place Today？" Nailing Two Thick Ass Neighbors In Cowgirl Everyday. Mio Kimijima Kurea Hasumi

  • kimishima mio hasumi claire censoredslutMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-084MIAA084miaa00084
    • 2019-05-23
    138 min

    [SW-633]When Her Voluptuous Ass In Black Pantyhose Touches My Dick In The Bus On My Way To School, My Dick Reacts Straight Away! Turned On By My Young Dick, The Young Lady Can't Stop Herself From Grabbing My Dick. There Were Other Passengers, But

  • censoredSWswitchtakeshi yamashiroswitch switchSW-633SW6331sw00633
    • 2019-05-19
    117 min

    [HND-670]Creampie Sex With A Perverted Girl Who's All About "Opposites" ~My Bewitching Girlfriend Does The Complete Opposite Of What I Ask~ Yu Shinoda

  • shinoda yu censoredcreampieslutHNDhon nakausa pyonHND-670HND670hnd00670
    • 2019-05-17
    141 min

    [VRTM-429]She's Only Wearing Hot Pants, But She's Not Wearing Panties! Seeing Flashes Of His Older Stepsisters Cunt, This Cherry Boy Little Stepbrother Is Suddenly Rock Hard! Unable To Hold Back, He Jumps His Stepsister For A Quickie! His Fir

  • akemi miu ayumi reika censoredcreampiesisterVRTMv r produceyamanaka socksVRTM-429VRTM429h-910vrtm00429
    • 2019-05-16
    180 min

    [MVSD-384]Her First And Best Anal Sex. Her First Orgasm! Embarrassing Orgasm! Anal Climax! Sena Asami

  • ashamed censoredanalsingle workMVSDm s video groupkogoro kindaichiMVSD-384MVSD384mvsd00384
    • 2019-05-16
    156 min

    [HUNTA-600]I Got Super Excited Over My Big Sister-In-Law's Tight Ass, So I Pulled Up Her Pants Around Her Knees, Mermaid Style, And Pumped Her Until She Had Consecutive Violent Orgasms! My Big Sister-In-Law Is A Tomboy Who Never Wears Skirts, But

  • censoredcreampiesisterHUNTAhuntercognac kaminohhh groupHUNTA-600HUNTA600hunta00600
    • 2019-05-01
    300 min

    [DROP-036]These Amateur Girls Are Going Cum Crazy With Their First Ass-Shaking Dildo Masturbation Experience Super Selections Of Beautiful Girl Babes 5-Hour Special!!

  • censoredamateurDROPoffice k sdrop office k sDROP-036DROP03636drop00036
    • 2019-04-13
    240 min

    [HUNTA-584]My Stepsister Has A Super Beautiful Ass And Her Ass Cheeks Peek Out From The Bottom Of Her Hot Pants! My New Younger Stepsister Has A Beautiful, Sexy Ass!! Pantyshot Under The Skirt Of Her Uniform! Her Loungewear Shorts! But Above All, Her

  • censoredschoolgirlsisterHUNTAhunterkawajirihhh groupHUNTA-584HUNTA584hunta00584
    • 2019-04-12
    149 min

    [VRTM-421]When This Freshly Graduated Kind And Gentle Big Sister With A Big Ass Came Into The Office Wearing Black Pantyhose, She Blew My Mind! Her Little Brother Couldn't Stop His Out Of Control Erection And Starting Rubbing His Cock Against Her

  • ayumi reika risa mochizuki censoredsisterVRTMv r produceeigo mochizukiVRTM-421VRTM421h-910vrtm00421
    • 2019-04-05
    160 min

    [DVDMS-383]I Gave In To My Big Stepsisters Big Ass Temptation And Fucked Her Raw And Creampie Ejaculated In Her Pussy Over And Over Again (This Is A True Story) While Our Parents Were Away On Vacation, My Big Sister, Who Loves Me Too Much, And I Were

  • censoredcreampieamateurDVDMSdeep sluminaxDVDMS-383DVDMS383dvdms00383
    • 2019-03-31
    153 min

    [MMKZ-056]This Elder Sister Has An Excessively Big Ass That Will Blow Your Mind In Seconds!! Yu Shinoda

  • shinoda yu censoredsingle workMMKZmarrionkojiro miyamotoirisMMKZ-056MMKZ056mmkz00056
    • 2019-03-15
    106 min

    [ZEX-368]This Elder Sister Who Works For A Housekeeping Service Has Slutty Tits That Are So Amazing You Won't Be Able To Resist!!

  • erica kitagawa censoredcreampiebig titsZEXpeters maxhideki hormonZEX-368ZEX368h-720zex00368



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored