beautiful girl amateur jav javcensored pov




FC2AUKSSQTEWAAACAWDDASDMARAMIAAADNMIDVONEZSANPREDSTARSPPPDAWDAUKGVENUBBANNACRCHRV

2020-10-15
34 min

[orec-609]かおりさん

  • amateur censoredbig titsamateurorecorec-609orec609orec-609
    • 2020-10-16
    240 min

    [MBM-219]First-Time Customers Welcome! This Horny Housewife Is Going Viral For Adultery Creampie Sex Into A Horny Wife's Pussy Who Has A Very Low Threshold For Sex 12 Ladies 4-Hour Special 4

  • censoredcreampieamateurMBMprestigegaro sasazukambmMBM-219MBM219118mbm00219
    • 2020-10-18
    105 min

    [VENU-971]I Mistook My Mother-In-law's Booty For My Wife's And Slipped My Cock Inside Her! Yu Shinoda

  • shinoda yu censoredcreampiebig titsVENUvenuspeterfakecest winntersVENU-971VENU971venu00971
    • 2020-10-23
    48 min

    FC2PPV 1544040 I was in trouble with money and went to shoot. I will not talk deeply [Personal shooting]

  • amateur uncensoredfc2
    • 2020-11-01
    60 min

    DIZ-008 Mari

  • amateur censoredcreampieamateurdizdiz-008diz008diz-008
    • 2020-11-01
    125 min

    [DBVB-030]The Shaming Of A She-Male Investigator Cruel Orgasms File No. 001 The Tragedy That Befell Shuri Nakajima After Her Illustrious Career Juria Takigawa

  • julia takigawa censoredanalsquirtingDBVBbabyentertainmentvenus babyDBVB-030DBVB030dbvb00030
    • 2020-11-19
    133 min

    [KTKZ-078]She Can Take Both Hands - Amateur Anal Fisting Slut Shows Her Ultimate O-Face Yumi (41 Years Old)

  • censoredKTKZkitixx mousouzokushinjinKTKZ-078KTKZ078ktkz00078
    • 2020-12-01
    124 min

    [MARA-057]H-Cup Theatre - Ran Shiono's Colossal Tits!

  • ran shion censoredcreampiebig titsMARAplanet plusdirector omarakasMARA-057MARA057h-237mara00057
    • 2020-12-03
    242 min

    [SHIC-177]My StepK*d 4-Hour Collection 4

  • censoredbeautiful girlSHICshishunki.comSHIC-177SHIC177
    • 2020-12-10
    130 min

    [MEKO-198]Married Woman Who Took A High Paying Part Time Job As A Nude Art Model Fucked And Filled With Cum 31

  • censoredcreampieamateurMEKOmilf laboMEKO-198MEKO198h-1160meko00198
    • 2020-12-12
    79 min

    [HHKL-076]When We Missed Our Last Train Home, I Spent The Entire Night Fucking My Part-Time Job Co-Worker Until The Break Of Dawn, And That Day, We Felt Like Lovers. Chiharu Sakurai

  • chiharu sakurai censoredcreampiebeautiful girlHHKLhunterspace nyanjirohhh groupHHKL-076HHKL076hhkl00076
    • 2020-12-20
    119 min

    [NNPJ-425]Home Town Country Slut In The Big City. She Came To The Capital To Party, Gets Brought Home By City Boys, Pumped And Dumped! (Wit A Quickie). She's An H-Cup!

  • censoredcreampieNNPJnanpa japanNNPJ-425NNPJ425nnpj00425
    • 2020-12-26
    112 min

    390JAC-073 [God Iki Goddess x Big Breasts H Cup x Raw Saddle 4 Barrage] “My wish is to squeeze all sperm” Ultimate H huge breasts gal who fell down on the gal! !! Explosion! convulsions! Great cum! I repeat it over and over again! !! I don&

  • amateur censoredcreampiebig titsjacjac-073jac073390jac-073
    • 2021-01-08
    125 min

    [GUN-846]Breast Milk Slut Ami Kasai

  • kami ami censoredcosplayslutGUNradixshio sakurababatsugun paradoxGUN-846GUN846433gun00846
    • 2021-01-10
    121 min

    [AUKG-503]Tiny Tits x Beautiful Tits - Mouth-Watering Lesbian Sex - Awakening To Her Desires Through Pussy Juice - Kanna Abe Sara Kagami

  • uno sakina abe sakina kagami sara censoredlesbiandramaAUKGu krentoAUKG-503AUKG503aukg00503
    • 2021-01-11
    45 min

    362SCOH-023 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [● Red]

  • amateur censoredcreampieamateurscohscoh-023scoh023362scoh-023
    • 2021-01-15
    120 min

    [MDTM-695]All POV: Sugar Baby In Uniform Miu Narumi

  • narumi miu censoredcreampieuniformMDTMuchu kikakutodoMDTM-695MDTM695h-585mdtm00695
    • 2021-01-15
    51 min

    328HMDN-328 [Amateur / Personal shooting] Real cheating video of a 39-year-old wife with a beautiful breasts nice body A big cock is screwed into a tight waist and seeded. Eros is too harsh to go around and die!

  • amateur censoredcreampiebig titshmdnhmdn-328hmdn328328hmdn-328
    • 2021-01-23
    143 min

    [OBA-411]My Friend's Mother Is A Prim And Proper, Conservative Woman But Eri-san Turned Out To Be A Super Horny Babe Who Will Fuck Me So Hard She Drained My Balls Of All My Semen... Eri Takigawa

  • eri takikawa misato arisawa censoredcreampiebig titsOBAmadonnabieber gonzoobasanOBA-411OBA411oba00411
    • 2021-01-31
    482 min

    [JUJU-263]Beautiful Wives Only - Gorgeous Married Sluts Pounded Right Down To Their Wombs With Massive Cocks! Moaning In Ecstasy For Creampie Fucks! 40 Girls, 8 Hours

  • censoredcreampiemature womanJUJUjukujo japanJUJU-263JUJU263juju00263
    • 2021-02-02
    60 min

    [KBTV-063]A Married Woman Shows A Face Other Than What Her Husband Sees - Nana-san

  • censoredmarried womanamateurKBTVclass s amateurKBTV-063KBTV063h-244kbtv00063
    • 2021-02-06
    117 min

    [JUL-469]All Alone With My Hot Stepmom During A Power Outage... It All Started By Accident, But It Led To An Indecent Creampie Relationship. Yuko Shiraki

  • shiraki yuko censoredcreampiebig titsJULmadonnashiro shotenJUL-469JUL469jul00469
    • 2021-02-22
    64 min

    SIRO-4389 [First shot] [Fair-skinned Sunrender JD] [Number of cums XX times] An active female college student with a cute smile. She is ashamed but feels sensitive body, but she is scared many times .. Application amateur, first AV shooting 196

  • amateur censoredsquirtingamateursirosiro-4389siro4389siro-4389
    • 2021-03-05
    118 min

    [GMAX-001]My Very Own Flat Chested Naked Girlfriend Huge Increase G-MAX Edition

  • amateur censoredsisterGMAXorustak softGMAX-001GMAX001
    • 2021-03-07
    136 min

    [TSF-015]You're A Male Office Worker, But When You Wake Up In The Morning, You've Discovered That You've Become A Woman (20) A Thorough Investigation You Were Bi And Absolutely The Dominant One, But Now You're Cumming Like A Bitch And

  • ao itaba censoredcreampiebeautiful girlTSFkaguyahimept mousouzokugynecomastia reportTSF-015TSF015tsf00015
    • 2021-03-25
    125 min

    [JRZE-037]First Time Filming My Affair - Nanako Agawa

  • nanako agawa censoredcreampiemature womanJRZEcenter villagejiro fukagawajurakuJRZE-037JRZE037h-086jrze00037
    • 2021-04-02
    122 min

    [NKKD-202]Traffic Accident Settlement Cuckholding Her Husband Caused An Accident And As Part Of The Settlement She Has To Become A Sex Toy For The Victim Kanna Misaki

  • kanna misaki censoredcreampiebig titsNKKDjet eizomanji groupNKKD-202NKKD202nkkd00202
    • 2021-04-18
    125 min

    [CESD-997]Tear-Filled Nonstop Cumming Sex 6 Mao Watanabe

  • mao watanabe censoredmature womansingle workCESDceleb no tomoCESD-997CESD997cesd00997
    • 2021-04-21
    78 min

    [ZOZO-059]Shame! New Female Teacher Is Made To Be A Nude Art Model! Rui Minagawa

  • censoredcreampiebig titsZOZOsadie willenauZOZO-059ZOZO0591zozo00059
    • 2021-06-10
    161 min

    [DANDY-767]"If You Keep Touching Me There... I'm Going To Want To Fuck!" This Annoying Big Tits Lady Is Becoming A Member Of the M****ter Teachers By Pressing Her Big Titties Against This Naive And Innocent Young Boy vol. 2

  • censoredbig titsblowjobDANDYdandykikujiro otsuDANDY-767DANDY7671dandy00767
    • 2021-06-16
    125 min

    [GVH-246]Naughty Nurses Satomi Suzuki

  • satomi suzuki censoredcreampiegrandfatherGVHglory questham the mcGVH-246GVH24613gvh00246
    • 2021-06-23
    73 min

    FC2PPV 1883334 Genuine performing arts [Complete appearance in the main story after purchase] Real active underground idol appearance, divine milk, outstanding style, fair-skinned silky skin, vaginal cum shot seeding, "personal shooting" indi

  • amateur uncensoredfc2
    • 2021-07-14
    245 min

    [HUNTB-062]"I Can't Do It Anymore! You're Going To Break My Pussy! Pull Out, Please!!" No Matter How Many Times He Cums, This Young And Horny Cherry Boy's Erection Just Keeps On Cumming For More And He Kept On Fucking His Slutty B

  • censoredcreampiesisterHUNTBhuntervolvo nakanohhh groupHUNTB-062HUNTB062huntb00062
    • 2021-08-20
    162 min

    [CAWD-267]She Said Just 1 But She Comes Back For More Since She Can"t Forget The Pleasure! Ayami Emoto Gets Her First Creampie See Her Get Aroused To The Limit, Thrust After Thrust! After 5 Months, See Her Get Pounded Hard Like A Piston For Nonst

  • ayami emoto censoredcreampiesquirtingCAWDkawaiikyouseiCAWD-267CAWD267cawd00267
    • 2021-08-21
    138 min

    [CEAD-357]Glasses Sex 3! Wan Horikita SEX Wearing Black Rimmed Glasses: Uniform, Glasses SEX: Recruit Suits & Glasses SEX And...

  • horikita wan censoredmature womansingle workCEADserebu no tomoCEAD-357CEAD357cead00357
    • 2021-09-10
    477 min

    [OFJE-328]Celebrity Riri Nanatsumori First-Time Best S1 Debut 1-Year Anniversary. Latest 11 Titles, 8-Hour Special

  • nanatsumori riri censoredbeautiful girlsingle workOFJEs1 no 1 styleOFJE-328OFJE328ofje00328
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-18
    148 min

    [FLAV-280]Slutty Bunny Girl Is A Carnivorous Masochistic Bitch Alice Otsu

  • otsu alice censoredbig titssquirtingFLAVdigital arkdigital ark dejitarua kuFLAV-280FLAV280flav00280
    • 2021-09-21
    27 min

    FC2PPV 2231059 [Individual] A Newly-Married Busty Pregnant Woman With Black Nipples Commits With Two Sticks And Stains The Vagina. * 1 Week Limited Release

  • amateur uncensoredfc2
    • 2021-09-24
    95 min

    [VENX-075]"Hey... Why Are You Twitching So Hard There" Expert Slut Reverse Pick Up. Sudden Male Squirting. Yu Shinoda , Hibiki Otsuki

  • kujo michiru censoredcreampiemature womanVENXvenuspe taincest vi nasuVENX-075VENX075venx00075
    • 2021-09-29
    481 min

    [ID-023]A Shaved Pussy Beautiful Girl Cosplay Video Collection 2-Disc Set 8 Hours

  • alice mizushima ryo enomoto censoredcreampiecosplayIDplumposter rawgunzshirouto only plumID-023ID0235526id00023
    • 2021-10-01
    145 min

    [JUNY-045]Her Tempting Ass Is So Big It Pokes Out Without Her Knowing! Huge Ass Teacher"s Anal Climax Life, Shiori Kimura

  • shiori kimura censoredcreampiebig titsJUNYfitchnikuyokuJUNY-045JUNY045juny00045
    • 2021-10-15
    122 min

    [TPPN-208]The Return Of The Sure Thing Misuzu Kawana The High Tide Of Excitement, Slathered With Sweat, Bodily Fluids, And Cum The Furious, Crashing Waves Of Ultimate Pleasure

  • misuzu kawana censoredsingle workbukkakeTPPNteppanTPPN-208TPPN208tppn00208
    • 2021-11-06
    120 min

    [REAL-782]A S********l Who Is Hard At Work, Studying For Her Entrance Exams, Is Panting And Moaning And Repeatedly Cumming While She Receives A Private, Aphrodisiac-Fueled Lesson Maika Hiizumi

  • maika hizumi censoredschoolgirlsingle workREALk m producejoni shibuyareal real worksREAL-782REAL782real00782
    • 2021-11-08
    65 min

    328HMDN-425 [Domazo] A Beautiful Miyuki Susuki I Met At The Happening Bar. She Talks To A Married Woman And Takes It Home. Chestnut Uvula & Sensitive Squirting That Gets Caught In Big Cock Irama A Large Amount Of Bukkake Conceived In The Uterus An

  • amateur censoredcreampiemarried womanhmdnhmdn-425hmdn425328hmdn-425
    • 2021-11-18
    52 min

    H4610 ki211118 Miyabi Mori 28years old

  • amateur uncensoredh4610
    • 2021-11-27
    40 min

    H0930 ki211128 Chisato Miura 40years old

  • amateur uncensoredh0930
    • 2021-12-02
    155 min

    [ABW-176]唯月優花 なまなかだし 42 どエロH乳美女にぶち込む特濃10連発！！！【MGSだけのおまけ映像付き 20分】

  • amateur censoredcreampiebig titsabwabw-176abw176abw-176
    • 2021-12-03
    99 min

    [BF-650]Giving A Creampie Load And Slutty Fun To My Vulnerable Younger Step-sis That Always Has A Micro-Bikini On. Misono Mizuhara

  • suwon miso censoredcreampiebig titsBFbefreeBF-650BF650bf00650
    • 2021-12-10
    162 min

    [ROE-026]She Has Been Polished For Her Husband, And Now She Is Ready To Show You Her Mature Proportions... Sachika Kamine, 47, Av Debut-.

  • yukika kamine censoredmature womansingle workROEmadonnamametaro mamezawamonroeROE-026ROE026roe00026
    • 2021-12-24
    123 min

    [DFE-057]I Am Eating Up This Y********l. Rena Usami

  • reina usami censoredcreampieuniformDFEwaap entertainmentnishiki sasafearlessDFE-057DFE0572dfe00057
    • 2022-01-08
    136 min

    [MDS-899]Anything Is OK With The Perverted Call Girl Gal. Fuck As Much As You Want All Day Long. Natsu Tojo

  • natsu tojo censoredcreampiesingle workMDSuchu kikakujohnny shibuyaMDS-899MDS899mds00899
    • 2022-01-18
    51 min

    H4610 ki220118 Rie Obata 26years old

  • amateur uncensoredh4610
    • 2022-01-22
    101 min

    [NSFS-060]A Powerful Japanese-style Fuck That Turns Women On - Hikari Kisaki

  • hikari hime censoredmature womansingle workNSFSnagae stylegeorge fujimotoNSFS-060NSFS060nsfs00060
    • 2022-01-22
    64 min

    C0930 tk0051 Yumiko Nonoichi 28years old

  • amateur uncensoredc0930
    • 2022-01-28
    180 min

    [BANK-069]Creampie In An Open Air Hot Spring - A Sensitive Y********l With A Plump, Super Lewd Body And Amazing Natural H-cup Breasts

  • censoredcreampiebig titsBANKma ko ginkoutakechanBANK-069BANK069h-1495bank00069



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored