beautiful girl collection




FC2JUFEAPODIPXADNAWDMIDENACRVENUAUKGKSBJMILKNACXMIAASQTEGVHFSDSSPPPDMIDVGMEMSAN

2021-01-31
99 min

[VEC-464]I Took A Hot Married Woman Home From Her Part-Time Job For Creampie Sex Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsVECvenusbingo tamatsukamegami venusVEC-464VEC464vec00464
    • 2021-02-05
    75 min

    FC2PPV 1667679 ＃ 52 Tin A little awkward Icharab sex with Gundam picked up at Comiket and Aniota who likes vaginal cum shot [First shot] [Personal shooting] [Gonzo] [High quality]

  • amateur uncensoredfc2
    • 2021-02-06
    83 min

    FC2PPV 1674307 Limited to 200 pieces, 1480 PT! [Full-scale fetish with appearance, uncensored, raw squirrel] God BODY beautiful girl and finally raw squirrel w self-insertion demon stakeout riding in agony cum shot & blowjob mouth shot reverse cu

  • amateur uncensoredfc2
    • 2021-02-12
    35 min

    S-Cute 828_miruka_01 SEX with uniform daughter as it is done / Miruka

  • miruka censoredschoolgirlamateurmirukamiruka-01miruka01828-miruka-01
    • 2021-02-12
    143 min

    [HONB-205]Beach (Bitch) - POV Footage With Hot Girls - 2 Sluts Scored!

  • censoredbig titsamateurHONBmercurythe first shibuya special f e headquarHONB-205HONB205h-1133honb00205
    • 2021-02-21
    227 min

    [REXD-351]Shameful Fucking A Prim And Proper Sadistic Class Representative Gets Abducted And Tied Up And Placed Under Confinement "You've Always Made A Fool Out Of Me!" "Well, Now It's My Turn To Make A Fool Out Of You!"

  • censoredcreampieschoolgirlREXDredmanji groupREXD-351REXD351rexd00351
    • 2021-02-27

    C0930 ki210227 Self Shot

  • amateur uncensoredc0930
    • 2021-02-27
    155 min

    [MIAA-401]College Girl Private Tutor Whispers Sweet Dirty Words! "But I've Already Cum...!" She Completely Drains My Dick Dry - Hina Nanami

  • hina nanami hina nanase censoredcreampieblowjobMIAAmoodyzkyoseieveryone s porn starMIAA-401MIAA401miaa00401
    • 2021-03-06
    146 min

    [SHKD-932]Beautiful Young Swimmer Girl In Swimsuit Thoroughly Trained By Middle-Aged Man - Asuka Momose

  • momose asuka censoredbeautiful girlsingle workSHKDattackersjo stylesharkSHKD-932SHKD932shkd00932
    • 2021-03-11
    113 min

    [FSDSS-181]Soapland With The Ultimate Technique Master! Sora Amagawa

  • tenkawa sora censoredbig titssingle workFSDSSfalenoponyfaleno starFSDSS-181FSDSS1811fsdss00181
    • 2021-03-13
    168 min

    [MIAA-404]See This Face Pussy Babe's Mouth Bulge When It's Full Of Cock The Anaconda Tongued Woman This Lady Boss Is Breaking In Her Deep Throat With Dick Sucking Glee Yumi Saeki

  • yuka saeki censoredblowjobdeepthroatMIAAmoodyzkogoro kindaichieveryone s porn starMIAA-404MIAA404miaa00404
    • 2021-03-13
    119 min

    [IPX-623]Ms. Rio Is A Blatantly Cute Babe Who Will Suck The Shit Out Of Your Cock With A Smile With An Amazing Blowjob Rio Kuriyama

  • rio kuriyama censoredblowjobsingle workIPXidea pocketdishIPX-623IPX623ipx00623
    • 2021-03-14
    71 min

    492MERC-269 Countryside Chari Girls ○ Student 2

  • amateur censoredschoolgirlamateurmercmerc-269merc269492merc-269
    • 2021-03-25
    91 min

    432YKMC-053 LiSA(20)

  • amateur censoredcreampiebig titsykmcykmc-053ykmc053432ykmc-053
    • 2021-03-27
    144 min

    [JKSR-485](Leaked Video) S********ls - Sports Training Camp Sex 2 - Sex, Night Visits, Ravished In A Three-Some, Baths, Peeping On Change Rooms... Totally Naughty Footage

  • censoredcreampieschoolgirlJKSRbig morkalprink junkyJKSR-485JKSR48557jksr00485
    • 2021-04-14
    192 min

    [HUNTA-987]Now I Can Get Laid Any Time, With Anybody I Want... My Sharehouse Is Full Of Busty College Girls And I Can't Concentrate On Studying For Exams...

  • censoredcreampiebig titsHUNTAhuntervolvo nakanohhh groupHUNTA-987HUNTA987hunta00987
    • 2021-04-17
    118 min

    [HND-978]Cuckholding Video Of Girlfriend Being Given Aphrodisiacs And Fucked By A Man She Hates Over And Over Rika Mari

  • mari rika censoredcreampiebeautiful girlHNDhon nakabacon tanakaHND-978HND978hnd00978
    • 2021-04-24
    118 min

    [HOKS-095]The Life Of A Middle Aged Couple Who Get Along With Each Other

  • yuka hirose kyoko kubo censoredmature womandramaHOKSfa prokinzo ogurokkuHOKS-095HOKS095hoks00095
    • 2021-05-05
    84 min

    259LUXU-1426 Luxury TV 1400 An Innocent President’s Daughter And President’s Secretary With One Experienced Person Appears In AV To Know The Outside World! The outstanding glamorous body that is disproportionate to the cute looks that seem

  • amateur censoredbig titsamateurluxuluxu-1426luxu1426259luxu-1426
    • 2021-05-11
    55 min

    H4610 ki210511 Yuka Yamaguchi 22years old

  • amateur uncensoredh4610
    • 2021-05-13
    119 min

    [ZEAA-061]Bukkake Masochistic Wife Beautiful Masochistic Wife Gets Covered In Cum By Group Of Men Kayo Iwasawa

  • kayo iwasawa censoredmarried womanmature womanZEAAcenter villagesky cloudsthe pole center villageZEAA-061ZEAA061h-086zeaa00061
    • 2021-05-14
    238 min

    [PPBD-211]Getting Drenched In Thick Cum! Titty Bukkake Rush 115 Shots

  • kazama yumi satomi suzuki censoredbig titsslutPPBDoppaiPPBD-211PPBD211ppbd00211
    • 2021-05-14
    120 min

    [PPPD-929]Getting Horny Seeing My SIster-in-law's Big Tits When She Came Home After Having Been Fucked! I Followed Her And Creampied Her After Some Rough Sex... Eimi Fukada

  • emi fukada censoredcreampiebig titsPPPDoppaiPPPD-929PPPD929pppd00929
    • 2021-06-04
    86 min

    [ETQR-243](Breaking In POV) Married Woman Wants To Get Knocked Up By A Massive Cock Karina, Age 33

  • censoredcreampiemarried womanETQRerotic timeETQR-243ETQR243etqr00243
    • 2021-06-16
    146 min

    [ROYD-059]When You Pressed Your Dick Up Against Your Cheeky Coworker You Thought For Sure She'd Be Mad, But Instead It Felt So Good You Ended Up Fucking Until Dawn Yuno Hanasaki

  • yuno hanasaki censoredcreampieblowjobROYDroyalcognac kaminohhh groupROYD-059ROYD059royd00059
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-20
    96 min

    [VNDS-3368]A Married Woman Who Sells Life Insurance With A Blowjob 3

  • censoredblowjobhandjobVNDSstar paradisenext toilet r eVNDS-3368VNDS3368h-254vnds03368
    • 2021-06-20
    292 min

    [NSFS-005]The Body Of A Nasty Bride Who Makes Her Father-in-law Go Crazy: BEST 3

  • makoto ito roaring sound censoredmature womandramaNSFSnagae stylenagaeNSFS-005NSFS005nsfs00005
    • 2021-06-24
    57 min

    413INST-133 Orgy 5P] H & F Cup Big Breasts ♀ x2 and swallowing raw squirrel orgy (20) (25) Dick and pussy raw squirrel all over the house, full of sake, sperm and tide

  • amateur censoredcreampiebig titsinstinst-133inst133413inst-133
    • 2021-06-24
    120 min

    [FSDSS-245]Reverse Cuckolding: "But My Wife Is Waiting For Me At Home..." Having Missed The Last Train Home After A Friday Night Company Party, I Ended Up In A Hotel Alone With My Big-Titted Younger Coworker. She Went Total Slut On Me And Mil

  • yuko ono censoredbig titssingle workFSDSSfalenoyamaguchi memberfaleno starFSDSS-245FSDSS2451fsdss00245
    • 2021-07-08
    93 min

    HOI-190 Seria

  • amateur censoredamateurhoihoi-190hoi190hoi-190
    • 2021-07-27
    125 min

    [KIRE-052]Instructions To Be A Pocket Pussy: A Neat And Clean Married Woman Is Synchronized Into Being A Disposable Pocket Pussy. Sumire (Violet) Kurusu.

  • kurusu sumire censoredcreampiemarried womanKIREsod createichigoharabeauty kirei sodKIRE-052KIRE052
    • 2021-07-27
    135 min

    [STARS-422]The Stepcousin That Came Back For Summer Vacation Seduces Her Stepcousins And Jerks Them All Off! 10 Shots In Total! Himari Asada

  • asada himari censoredbig titssoloworkSTARSsod createyosukesod starSTARS-422STARS422
    • 2021-07-31
    215 min

    [SORA-326]Blow Job Friends, Cum Swallowing J-Style Date Natsu Tojo

  • natsu tojo censoredschoolgirlblowjobSORAyama to soradenchuuSORA-326SORA326sora00326
    • 2021-08-06
    180 min

    [EYAN-172]30 Years Old, In The Height Of her Sex Drive. The Astounding J-cups Are Out Of Control. E-BODY Exclusive Housewife Debut.

  • miki shiraishi censoredbig titssingle workEYANe bodyusapyonhanazakari no tsumatachiEYAN-172EYAN172eyan00172
    • 2021-08-06
    24 min

    FC2PPV 1958149 Limited Number! !! [Uncensored] Creampie In The Super Sensitive Body Of The Designated No1 Therapist With A Lewd Pheromone! !!

  • amateur uncensoredfc2
    • 2021-08-21
    240 min

    [OKAX-767]Penis Addiction 2: The Girl Who Loves Hard Cocks And Gets Wet From Giving Head

  • rin kuramochi sakura mochizuki riko nanami censoredblowjobslutOKAXk m produceokazuOKAX-767OKAX767okax00767
    • 2021-08-29
    58 min

    FC2PPV 2101721 A Girl Who Was Sleeping At An Internet Cafe. A Girl Who Couldn’t Stand The Leap By Her Father-In-Law And Left Home With Loneliness And Despair. She Licks Her Unfinished Body And Makes A Lot Of Vaginal Cum Shot In Her Immature Puss

  • amateur uncensoredfc2
    • 2021-09-05
    125 min

    300MIUM-743 [Large Excavation! !! Super Idol Class Girlfriend] Rent An Active Esthetician With Beautiful Face, Beautiful Voice, And Beautiful Breasts As Her! Completely Rec The Whole Story That Was Spoiled Up To The Originally Prohibited Erotic Acts

  • amateur censoredcreampieamateurmiummium-743mium743300mium-743
    • 2021-09-09
    125 min

    [NEO-763]Gal Saliva Bullying Runa Shimotsuki

  • shimotsuki runa censoreddeepthroatsingle workNEOradixsakuraba kyuu kokoro otokoneo radixNEO-763NEO763433neo00763
    • 2021-09-10
    240 min

    [HUNTB-089]"Stop It, Big Bro" "No, That"s "Master" To You!" My Stepsister Got A Job Working At A Maid Cafe, So I Taught Her How To Handle Come-Ons From Customers - Her Reactions Are Totally Adorable

  • censoredcreampieblowjobHUNTBhuntermorikihhh groupHUNTB-089HUNTB089huntb00089
    • 2021-09-23
    190 min

    [STARS-411]【完全主観】もしも彼女がグラドルだったら…3時間4SEX 天宮花南

  • amamiya kanan censoredbig titssoloworkSTARSsod createyazawa reshi busod starSTARS-411STARS411
    • 2021-10-02
    140 min

    [PKPD-164]H Cup Chubby Cosmetologist Fuck Buddy Misono Is Healing And So Cute, Misono Mizuhara

  • suwon miso censoredcreampiebig titsPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-164PKPD164pkpd00164
    • 2021-10-05
    64 min

    498DDH-038 [J ● Refre Voyeur] From The Moment I Met That Girl, My Big Tits Detector Started And My Heart Pounding Didn’t Stop! Good And Gentle, And Good At Recommending Options …! When I Was Struck By The Breasts And Continued To Provide Se

  • amateur censoredcreampiebig titsddhddh-038ddh038498ddh-038
    • 2021-10-08
    158 min

    [IPX-742]楓カレン流 極楽射精メンズエステ

  • karen kaede censoredhandjobsingle workIPXidea pocketoosaki hirokoujitissueIPX-742IPX742ipx00742
    • 2021-10-20
    35 min

    279UTSU-513 Asahi (Asahi Mizuno)

  • amateur censoredbig titsmarried womanutsuutsu-513utsu513279utsu-513
    • 2021-11-05
    162 min

    [JUL-772]Natsuki Takeuchi Releases Her First "Gokkun"! I"ve Been Made To D***k That Man"s Ugly Semen Morning, Noon, And Night. Sperm D***king "Real Sperm" X Ryo Drama

  • natsuki takeuchi censoredmature womansingle workJULmadonnatomitake taroJUL-772JUL772jul00772
    • 2021-11-15
    74 min

    328HMDN-427 [Real Aunt 55 Years Old And Sexual Intercourse] A Mature Woman (Miko Koda) Who Is Estrus To A Man Who Has Knowed From A Childhood And Is Cum Shot By Herself (Miko Koda)

  • amateur censoredcreampiemarried womanhmdnhmdn-427hmdn427328hmdn-427
    • 2021-12-04
    140 min

    [PKPR-005]Totally Private Videos This Beautiful Lady Is A Former Nurse Who Has H-Cup Titties And Is Squirting Like Crazy Your First Sleepover With Yayoi Yoshino Yayoi Yoshino

  • yayoi yoshino censoredcreampiebig titsPKPRpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPR-005PKPR005pkpr00005
    • 2022-02-12
    136 min

    [MYBA-043]Turning Over The Petals Of A Married Woman - Rino Yuki

  • yuki rino censoredcreampiebig titsMYBAhitozuma engokai emmanuelleihyo kairoiMYBA-043MYBA043myba00043
    • 2022-02-19
    61 min

    [HEYZO-2725]Emi Sakurai MILF"s Sexual Service at the Soapland Vol.4

  • emi sakurai uncensoredcreampieheyzo
    • 2022-02-19
    131 min

    [APNS-277]The Sales Technique Of Arriving Unannounced And Trading Sexual Favors. The Pushover Sales Lady. Non Ohana

  • florets censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-277APNS277apns00277
    • 2022-02-25
    109 min

    [RBK-041]貞操帯の女29 水谷心音

  • mizutani heart sound rio fujisaki censoredsingle workdramaRBKattackersyu mabukiryupakuRBK-041RBK041rbk00041
    • 2022-02-26
    64 min

    H0930 ki220227 Misato Sakata 28years old

  • amateur uncensoredh0930
    • 2022-03-08
    105 min

    [KTRA-385]Diary of Breaking In The Step-Niece, 2. Kohara Hanasaki

  • hanasaki koharu censoredKTRAk tribeutamaroKTRA-385KTRA385h-094ktra385e
    • 2022-03-19
    146 min

    [APAK-220]I Became...Such A Horny Slut...A Curvy With Big G Cup Tits Fucking An Older Guy At A Hotel! Noaa Amaharu.

  • ai tenharu censoredcreampiesingle workAPAKaurora project annexrkaurora project anexAPAK-220APAK220apak00220



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored