beautiful girl tits censored def jav




FC2SSNICAWDGVHHNDRBDHODVPPPDMILKAVSAHMNATIDWAAASSISAUKGFSDSSNATRHUNTBJULVEMAVENU

2024-02-16
150 min

EYAN-199 When She Worked At Men-S While Her Husband Was Working, She Became A Popular Girl Who Couldn"t Get Reservations. A Beautiful And Lucky Wife Who Can Only Be Seen On Weekdays. AV Debut Mai Koion

  • mai koine censoredbig titshandjobEYANe bodyusapyonhanazakari wivesEYAN-199EYAN199eyan00199
    • 2024-02-16
    180 min

    FPRE-018 Newcomer, Former Local Station Hcup Weather Girl Mio Yukihira AV Debut! The Beautiful Body Of A Young Lady Ejaculates In The First Shoot

  • yukihira mio censoredbig titssquirtingFPREfitchkyouseipreciousFPRE-018FPRE018fpre00018
    • 2024-02-16
    210 min

    PPPE-190 Returning To Okinawa From Tokyo With Sanshin! Hcup Big Breasted Islander Makes A Triumphant Return On The 3rd Anniversary Of Her AV Debut! Karen Yuzuriha

  • karen kaede censoredcreampiebig titsPPPEoppaiPPPE-190PPPE190pppe00190
    • 2024-02-16
    100 min

    MUDR-250 Water Honey Girl 1 & 2 A Boring Middle-aged Teacher With Creepy Glasses Sleep-rapes A Beautiful Girl With Big Breasts In A Uniform. Konatsu Kashiwagi

  • kashiwagi konatsu censoredcreampiebig titsMUDRinnocentMUDR-250MUDR250mudr00250
    • 2024-02-15
    83 min

    KAMEF-069 Specializing In Individual Photography Big Breasted Idol Photo Session Ai-chan (19) Machida Lens"s BLACK KAMEKO FILE.69 An Idol Who Knows Nothing Participates In An Obscene Photo Session Like A Part-time Job. Her Breasts Are Photographe

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-069KAMEF069h-1350kamef00069
    • 2024-02-15
    113 min

    HMRK-001 [Golden Ratio Erotic Body Healing Beauty] Although She Is Neat, She Likes Perverted Play! The Smile, The Blowjob Face, And The Orgasm Face Are All Cool! A Naughty And Beautiful College Girl With Beautiful Breasts And A Lovey-dovey Sex Video

  • miyanishi hikaru censoredcreampiebig titsHMRKdochameroku channelHMRK-001HMRK001h-1711hmrk00001
    • 2024-02-15
    92 min

    UINAV-002 [Bakki Baki Erotic Body] Mechashi Cosplay Slender Beautiful Breasts Muscle Training Girl Tipsy Muscle Protein Creampie On Cheat Day! ! [Chest Constriction Butt]

  • censoredcreampieUINAVhmn workshamedori.network secondeditionUINAV-002UINAV002h-1472uinav00002
    • 2024-02-02
    240 min

    NKM-005 Beautiful Body That You Want To Insert Every Day 4 Super Lewd Beauty SPECIAL 10 People 4 Hours

  • censoredcreampiebig titsNKMthis is it laymanNKM-005NKM005h-1631nkm00005
    • 2024-01-30
    261 min

    SPRO-095 Creampie Amateur POV Hot Spring Date Female College Student/Underground Idol/Gal X 2

  • censoredcreampiebig titsSPROamateur proSPRO-095SPRO095h-1594spro00095
    • 2024-01-27
    83 min

    CHC-004 Mariru-chan, 21 Years Old Mariru Narumi

  • narumi mariru censoredblowjobbeautiful girlCHCchc studioCHC-004CHC004h-1751chc00004
    • 2024-01-26
    26 min

    NJPD-010 Mitsuki Nagisa

  • scooping censoredcreampiebeautiful girlNJPDnew japan av actress directorynew japan av actress directoryNJPD-010NJPD010h-1754njpd00010
    • 2024-01-26
    118 min

    ORECS-108 Pick Up A Female College Student With Outstanding Model-class Style! She Is Wearing A Bunny Girl Outfit, Exposing Her Sexy Legs And Cleavage, And Swaying Her Ass As She Boldly Serves You! "I Feel It More Than Usual...//" The JD Bunn

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-108ORECS108h-1732orecs00108
    • 2024-01-25
    129 min

    PFT-001 Mankitsuchu Original Work By Haruto Torasuke"s Popular Doujin Comic Live-action! Nozomi Arimura

  • censoredcreampiebig titsPFTfaleno tubedazai chinpoPFT-001PFT0011pft00001
    • 2024-01-25
    140 min

    KANO-018 Amateur Sex Lovey-dovey Creampie VOL.3 Rei & Niina

  • misumi rei it s in tomikunaga censoredcreampiebeautiful girlKANOmonthly girlfriendKANO-018KANO0181kano00018
    • 2024-01-19
    123 min

    FOCS-171 A Childhood Friend I Met After A Long Time Turned To A Beautiful Girl With An Erotic, Beautiful Big Breasts Body. I Couldn"t Resist The Periscope Titjob From The Protrusion Of The Bathtub, So I Hid From My Parents And Had Sweet Lovemakin

  • miyanishi hikaru censoredbig titsblowjobFOCSabc delusion groupfocusFOCS-171FOCS171focs00171
    • 2024-01-16
    71 min

    SHSK-006 Get Raw Pussy! ! A Girl"s Serious Pseudo-love Document No.003

  • censoredcreampieblowjobSHSKthat s crazy amateur fame classSHSK-006SHSK006h-1741shsk00006
    • 2024-01-16
    67 min

    STZY-012 Treasured Footage Released Before AV Debut! A Sparkling 19 Year Old! A Girl Whose Baby-faced Big Breasts Are Too Dazzling! Nanase Aoi [Nuku With Overwhelming 4K Video! ]

  • nanase aoi censoredbig titsbeautiful girlSTZYsod createstar shootstar is onSTZY-012STZY0121stzy00012
    • 2024-01-12
    142 min

    ORECS-095 7P Big Orgy In Open Air Bath & 6 Beautiful Girls In Uniform Harem SEX With Full Body Licking

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-095ORECS095h-1732orecs00095
    • 2024-01-12
    93 min

    ORECS-096 Memories Of Being Attacked By Beautiful Girls At A Hot Spring Inn Rei Hinako Suzu

  • censoredcreampieschoolgirlORECSmy amateur z second impactORECS-096ORECS096h-1732orecs00096
    • 2024-01-06
    68 min

    INSTV-522 【芋巨乳ロリ従妹】Hcupナツミちゃん。夏休みに帰省したら成長してしっかりメスになってた従妹と中出しSEXしまくったハメ撮りビデオ

  • censoredcreampiebig titsINSTVhmn worksinstaINSTV-522INSTV522h-1472instv00522
    • 2024-01-03
    52 min

    INSTV-521 [Big Breasts Icup Beautiful Girl] Perfect Breasts 102cm! Female College Student Hana-chan (21) Raw Creampie Personal Video Of An Amateur Couple Who Are Particular About The Strongest Breasts

  • censoredbig titsamateurINSTVhmn worksinstaINSTV-521INSTV521h-1472instv00521
    • 2023-12-29
    170 min

    MIDV-590 A Tomboyish H-cup College Girl Takes On Her First Exciting Challenge At A Service Soapland Called Erika Isshin.

  • isshin erika censoredbig titsbeautiful girlMIDVmoody skyouseimoodyz divaMIDV-590MIDV590midv00590
    • 2023-12-25
    77 min

    COCH-040 Beautiful Beauty/Domoto Beauty

  • amateur censoredbig titsbeautiful girlCOCHintec incCOCH-040COCH040
    • 2023-12-25
    96 min

    COCH-038 Pretty Girl/Noeru Serizawa

  • noeru serizawa censoredbig titsbeautiful girlCOCHintec incCOCH-038COCH038
    • 2023-12-23
    63 min

    HNHU-088 Individual Shooting Pick-up #sauna Beautiful Girl #squirting #long Tongue Kiss #crunchy Nipples #raw Creampie

  • censoredcreampiesquirtingHNHUthat s rightHNHU-088HNHU088h-1658hnhu00088
    • 2023-12-22
    35 min

    AIDV-001 World"s First New AI Actress, Perfect Beautiful Face Ai Konohana AV Debut

  • kibana ai censoredbig titssquirtingAIDVh m pcrestfantasyAIDV-001AIDV0015642aidv00001
    • 2023-12-01
    64 min

    CLT-082 [Mio Edition] Limited To Female Students! A Game Of Guessing Her Boyfriend With Her Nipples And Dick Sticking Out Of The Wall! ! If You Guess, You"ll Get A Gorgeous Prize! If You Miss, You Will Have An Unexpected Punishment Game And Have

  • censoredbig titsschoolgirlCLTpetersCLT-082CLT082h-021clt00082
    • 2023-12-18
    178 min

    BRV-006 -Urgent MISSION- (Naughty) Pick Up A Prestigious Female College Student And Cum Inside Her! -Bunkyo Ward/Chiyoda Ward Edition-

  • censoredcreampiesquirtingBRVbravoBRV-006BRV006h-1755brv00006
    • 2023-12-15
    118 min

    ORECS-085 Naive Girls With Almost Zero Experience In Sexual Harassment Are Inspired By Their Bottomless Masochistic Hearts And Blossom Into Sadistic Women! Sarina & Mahiro

  • censoredcreampieamateurORECSmy amateur z second impactxyzORECS-085ORECS085h-1732orecs00085
    • 2023-12-08
    109 min

    ORECS-084 Naive Girls With Almost Zero Experience In Sexual Harassment Are Inspired By Their Bottomless Masochistic Hearts And Blossom Into Sadistic Women! Nanami Asuka

  • censoredcreampiebig titsORECSmy amateur z second impactxyzORECS-084ORECS084h-1732orecs00084
    • 2023-12-08
    136 min

    ORECS-083 Rina, A Female College Student Who Was Taken Home And Fucked, Aoi-sensei Who Kindly Brushed Me Down

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-083ORECS083h-1732orecs00083
    • 2023-12-08
    130 min

    ORECS-082 Successfully Secretly Filming A JD For Sex With The Guard. Get More Drunk And Have Sex With Raw Paco And Creampie. We Had Sex Until Morning...Ran & Nene

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-082ORECS082h-1732orecs00082
    • 2023-12-05
    201 min

    SDAB-285 Kurumi Amai AV DEBUT Full Of Innocence! Small Body With Well-developed G Cup

  • amai kurumi censoredbig titsbeautiful girlSDABsod createcrestyouthSDAB-285SDAB2851sdab00285
    • 2023-12-04
    58 min

    BRV-002 A Naughty Date With That Big-breasted Girl - Tokyo/Fukuoka Edition - She"s A Beautiful Girl, But She Also Has The Strongest Breasts!

  • censoredbig titssquirtingBRVbravoBRV-002BRV002h-1755brv00002
    • 2023-11-10
    62 min

    HNHU-082 Individual Shooting Pick-up # GET Of A Beautiful Girl With A Dark Side # Yariman Sex Beast # G Cup Beautiful Breasts # Continuous Convulsions # Begging Creampie

  • censoredcreampieamateurHNHUthat s rightHNHU-082HNHU082h-1658hnhu00082
    • 2023-11-27
    60 min

    INSTV-507 [Personal Shooting] A Beautiful Girl Who Is Envied By Everyone, OL Maina (24) With G Cup Big Breasts, Enjoys Confinement Play After A Date In The Park And Is A Perverted Meat Urinal Exclusively For Masochist Creampie. Couple"s Gonzo Vid

  • censoredbig titsamateurINSTVhmn worksinstaINSTV-507INSTV507h-1472instv00507
    • 2023-11-24
    54 min

    FTHT-163 [G Cup! Shaking Her Big Breasts] Cowgirl Position Moving Her Hips Up And Down! Die With A Thrusting Piston! [Suck Dick Too! I Will Do Titjob] I Will Accept Without Resistance As I Am Told! [The Trap Of The Girl Beauty Salon! Restrain And Mak

  • censoredbig titsbeautiful girlFTHTfaleno tubeFTHT-163FTHT1631ftht00163
    • 2023-11-24
    110 min

    FTHT-174 The Smoking Thing That Is The Talk Of The Town! ! Experience Pleasure At Womana○za! !

  • censoredbig titsbeautiful girlFTHTfaleno tubeFTHT-174FTHT1741ftht00174
    • 2023-11-20
    139 min

    DOCP-359 There Was One Plain Girl In The Class, But When She Took Off Her Clothes, She Had Big Breasts And Was More Erotic Than The Girls In The Army! Konatsu Kashiwagi

  • amateur censoredbig titsschoolgirlDOCPprestigedoc premiumDOCP-359DOCP359
    • 2023-11-17
    122 min

    ORECS-072 Take Home An Erotic Drunk College Girl Paco Paco Paco And College Girl Hi & Mayu

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-072ORECS072h-1732orecs00072
    • 2023-11-14
    73 min

    EROFV-217 Amateur JD [Limited] Mimi-chan, 22 Years Old, A Beautiful JD Who Is Proud Of Her Big Breasts! ! Contrary To Her Classy Appearance That Gives Off A Celebrity Atmosphere, She Is A Girl With Strong Breast Appeal, And I Violently Thrust Into He

  • censoredcreampiebig titsEROFVhmn workslove girlfriendEROFV-217EROFV217h-1472erofv00217
    • 2023-10-12
    67 min

    DORI-100 Paco Shooting No.100 Nina-chan, A Beautiful Girl With Small Breasts Who Feels So Good That She Allows Creampie, Nina Fukunaga

  • it s in tomikunaga censoredcreampieschoolgirlDORIfirst starpaco shootingDORI-100DORI100h-491dori00100
    • 2023-11-14
    181 min

    SDAB-277 Kira Sorano AV DEBUT The Idol Figure That Industrial Girls Admired. Now, From Work Clothes To The Sparkling World, Her Small Body And Big Sexual Desire

  • sorano kira censoredbeautiful girlSDABsod createyazawa receiveyouthSDAB-277SDAB2771sdab00277
    • 2023-11-13
    75 min

    NHDTB-86302 Molester Summer Festival 2023 Creampie Special Forest School Molester Fair-skinned Energetic J○

  • censoredcreampieschoolgirlNHDTBnatural highneapolitannatufileNHDTB-86302NHDTB863021nhdtb86302
    • 2023-10-20
    113 min

    MBDD-2097 Mirei Uno/Marshmallow Queen

  • uno mirei censoredbig titsbeautiful girlMBDDmedia brandMBDD-2097MBDD2097301mbdd02097
    • 2023-10-26
    204 min

    PIYO-184 A Child Like This Has No Choice But To Drink. [Amateur Excavation] My First Experience Was In Junior High School With The Teacher Who Was The Advisor For My Club Activity...! ？ A Super Sensitive F-cup Girl With White Skin Who Moans Cutely Ju

  • censoredsquirtingschoolgirlPIYOchickclown fieldPIYO-184PIYO1841piyo00184
    • 2023-10-25
    331 min

    SPRO-090 Daddy Life Sex Record~! Sexy Sex With The Best Beauties I Met On SNS! !

  • censoredcreampiebig titsSPROamateur proSPRO-090SPRO090h-1594spro00090
    • 2023-10-21
    61 min

    HNHU-079 Individual Shooting Pick-up #Munchy Naive Beautiful Girl #Hidden Big Breasts #Vacuum Tongue Chew #I Love Toys! #Continuous Demon Piss

  • censoredbig titsamateurHNHUthat s rightHNHU-079HNHU079h-1658hnhu00079
    • 2023-10-20
    65 min

    EMS-003 Convenient Free Man Record Tsumugi (19)

  • censoredamateurEMSbrollebeautiful girl collectionEMS-003EMS003h-1713ems00003
    • 2023-10-15
    216 min

    SNO-002 [Nakadashi X Beautiful Girl] Vol.002 Serious Middle Document Real Half Outside Half Inside! ! [1. Even Though She Has A Boyfriend, The Shop Clerk Is Seduced By The Cash In Front Of Her And Allows Her To Have Sex Raw And Creampied] [2. The G-c

  • censoredcreampiebig titsSNOsanji s side dishshinnosukeit s a real vaginal cum shotSNO-002SNO002h-1540sno00002
    • 2023-10-13
    59 min

    FTHT-144 [The Growth Is Incredible! Breasts With Amazing Cleavage! ] Pant Panting! Sensitive Pussy Girl! [What Is This! Wow, Has It Become This Much？ 】Do You Smell Something？ [Amazing Bing! I"ll Lick It] I"ll Squeeze Your Dick While Licking Y

  • censoredcreampiebig titsFTHTfaleno tubedavielFTHT-144FTHT1441ftht00144
    • 2023-10-13
    120 min

    ORECS-053 Half JD Rin & Beautiful Big Tits JD Misa"s Brain-bugging Convulsions Climax Sex If You Can Endure The Amazing Techniques Of A Handsome AV Actor, You"ll Get 1 Million Yen! Once She Cums, She Mercilessly Cums Raw With A High-speed Pis

  • censoredcreampiebig titsORECSmy amateur z second impactone topORECS-053ORECS053h-1732orecs00053
    • 2023-10-13
    60 min

    FTHT-164 "Can You Please Touch My Dick？" An Amateur Girl Gives Me A Hand Job And A Blowjob, And I Ejaculate A Lot! 02

  • censoredbig titsamateurFTHTfaleno tubedavielFTHT-164FTHT1641ftht00164
    • 2023-10-13
    62 min

    FTHT-147 [Suck It In Your Mouth While Teasing It! A Stylish Jay Type! 】Short Height! Temptation Of The Minimal Naive Child! [Uncle, Do You Want To Play With Me？ (Masturbation) Just Look？ ] It"s Hentai, So You"re Jerking Off Like That Every Da

  • censoredcreampieschoolgirlFTHTfaleno tubedavielFTHT-147FTHT1471ftht00147
    • 2023-10-13
    60 min

    FTHT-141 [A Naughty And Masochist Jay Who Plays With His Cock! 】The Temptation Of Plump Thighs That Are Still Developing! [I Didn"t Lick It ♪ I Just Tasted It! 】Don"t Cum Until I Tell You To Go! [It"s Delicious! Give Me More! 】Cock"s.

  • censoredcreampiebig titsFTHTfaleno tubedavielFTHT-141FTHT1411ftht00141
    • 2023-10-12
    78 min

    ETQR-501 Sex With A Frustrated Big-breasted Slutty Lady SHOUKO

  • censoredcreampiebig titsETQRerotic timeETQR-501ETQR501etqr00501



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored