best omnibus censored high vision jav javcensored




FC2LULUJUFESHKDGVHAMBIKSBJHDKASQTESTARSSSISCHRVPPPDVEMAMIAASPRDMEYDWAAADTTCESDHZGD

2020-10-01
120 min

[NACR-356]A Runaway And Me - Tsukasa Nagano

  • tsukasa nagano censoredcreampieblowjobNACRplanet plussakura ninshichi ku ryuuNACR-356NACR356h-237nacr00356
    • 2020-10-01
    241 min

    [C-2579]Married Woman Self-shot NTR: Cuckold Report Video THE BEST 2019.04-2020. 01

  • censoredCgogosgogo s coreC-2579C2579140c02579
    • 2020-10-03
    51 min

    H0930 ori1584 Saori Nantani 36years old

  • amateur uncensoredh0930
    • 2020-10-13
    68 min

    FC2PPV 1532876 ＃ 41 Hazuki: Hazuki and Offpaco are cute like idols. Sprinkle the tide and panting Twice in a row at the age of 22 [Personal shooting] [Gonzo] [High image quality]

  • amateur uncensoredfc2
    • 2020-10-22
    59 min

    465ANT-702 Satomi

  • amateur censoredamateurblowjobantant-702ant702ant-702
    • 2020-10-22
    50 min

    Pacopacomama 102220_374 Yuki Shinoda

  • yuki shinoda uncensoredcreampieuniformpacopacomama
    • 2020-10-24
    174 min

    [AKID-077]College Girl Babes Only After The Party, We Took Them Home For A Peeping Good Time And Then We Released The Footage Without Permission As An Adult Video No.41 A Neat And Clean Elder Sister Type College Girl Gets Slut Fucked With Creampie Se

  • censoredcreampiebig titsAKIDomochikaeri mousozokuno directorAKID-077AKID077akid00077
    • 2020-10-25
    151 min

    [APKH-155]This Service-Loving Sub We Met On A Hookup App Is A Busty College S*****t Who Wants To Become A Preschool Teacher! She Likes Riding Cock Cowgirl As Much As She Likes To Be Teased Yukino Nagasawa

  • yukino nagasawa censoredcreampiebig titsAPKHaurora project annexhaurora project anexAPKH-155APKH155apkh00155
    • 2020-11-06
    38 min

    [ore-716]Mitsuki 2

  • amateur censoredcreampieuniformoreore-716ore716ore-716
    • 2020-11-12
    113 min

    [GUN-746]Pissing Pussy In A Barely There Bikini

  • chiharu miyazawa nene tanaka censoredGUNradixshio sakurababatsugun paradoxGUN-746GUN746433gun00746
    • 2020-11-13
    244 min

    [SKMJ-132]"Won't You Help Your S*****t Graduate From His Cherry Boy Status？" Private Tutor Kindly Takes S*****t's Virginity - Secret Creampie Sex Education!!

  • censoredcreampieamateurSKMJred face girlyuseiSKMJ-132SKMJ132h-1324skmj00132
    • 2020-11-15
    239 min

    [WA-442]Tipsy Married Woman Cums - Lust Explosion, Squirting Masturbation vol. 4

  • censoredsquirtingamateurWAlotusWA-442WA442h-047wa00442
    • 2020-12-10
    122 min

    [FSDSS-140]Sweet, Spoiled Cowgirl Sex, Boosted By Piston-Pounding Thrusts Yume Nikaido

  • nikaido yume censoredbig titsbeautiful girlFSDSSfalenokirinfaleno starFSDSS-140FSDSS1401fsdss00140
    • 2020-12-10
    123 min

    [FSDSS-138]Massage Parlor G-Spot Training That Commands Her To Stare Right Into The Camera As Her Cunt Spasms Natsu Tojo

  • natsu tojo censoredbeautiful girlsingle workFSDSSfalenotake dfaleno starFSDSS-138FSDSS1381fsdss00138
    • 2020-12-25
    135 min

    [DTT-071]Married Young Hostess With Big Beautiful Tits, 32: Yu Kamijo's AV Debut!! Making Her Guests Feel Welcome With Her Big Beautiful Tits And Wet Pussy!!

  • yu uejo censoredbig titsmature womanDTTprestigeitoman akifumikanbiDTT-071DTT071118dtt00071
    • 2021-01-06
    66 min

    [sika-029]えーちゃん＆なーちゃん

  • amateur censoredschoolgirlamateursikasika-029sika029sika-029
    • 2021-01-08
    125 min

    [GUN-846]Breast Milk Slut Ami Kasai

  • kami ami censoredcosplayslutGUNradixshio sakurababatsugun paradoxGUN-846GUN846433gun00846
    • 2021-02-12
    150 min

    [DASD-810]"I'm Jealous, But I'm Getting Hard" She Is Most Beautiful When She Is Fucked By Someone Else. Natsuki

  • censoredamateurbeautiful girlDASDdashiromichi hoseDASD-810DASD810dasd00810
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-21
    144 min

    [JUL-478]I Lost My Comppany And My Wife. The President's Wife Cuckold Maki Tomoda

  • maki tomoda censoredbig titsmature womanJULmadonnajo styleJUL-478JUL478jul00478
    • 2021-03-05
    81 min

    [BRTH-029]Fucking A Beautiful Girl Who Aspires To Be An Idol During Class! Tomoko Matsushima

  • amateur censoredBRTHorustak softBRTH-029BRTH029
    • 2021-03-13
    155 min

    [JUFE-267]My Very Own Cock Sleeve - Shy, Sensitive Cosplayer With Big Tits Sucks Me Off Whenever I Want Edition Nenne Ui

  • first love censoredcreampiebig titsJUFEfitchJUFE-267JUFE267jufe00267
    • 2021-03-26
    54 min

    FC2PPV 1742624 [* White eyes attention *] 5P orgy ★ Ai Yak ★ A female college student who trembles with a lively face while peeling white eyes with Gangimari is too erotic! Super penis and muscular man gorilla SEX are dangerous. [Very ejaculated]

  • amateur uncensoredfc2
    • 2021-04-02
    105 min

    [RBK-010]Step Dad Sex Story Step Father Can't Resist His Step Daughter's Body While His Wife Is Gone For The Week And Makes Her His Own Kanon Ibuki

  • kanobuki censoreduniformbeautiful girlRBKattackerssadao sadaokaryupakuRBK-010RBK010rbk00010
    • 2021-04-08
    120 min

    [HBAD-579]The Sullied Unfaithful Housewife Moaning And Crying About Father-in-Law's Disciplinary Bondage Chinatsu Asamiya

  • chinatsu asamiya censoredsingle workHBADhibinonamitaro umababeHBAD-579HBAD5791hbad00579
    • 2021-04-14
    63 min

    SIRO-4484 [First shot] [Beautiful breasts nice ass cowgirl] [Immoral licking] The daughter of a long-established dry goods store that has continued for generations is the first rebellious period. Kimono that is usually well protected .. Application a

  • amateur censoredbig titsamateursirosiro-4484siro4484siro-4484
    • 2021-04-15
    65 min

    336KNB-150 I Can’t Be Satisfied With Sex With My Husband And Apply For AV! Contrary to the appearance that seems to be an adult, the sensitivity is good and the intense erotic reaction! !! A mysterious wife who trembles with a pleasant sensation

  • amateur censoredbig titsmarried womanknbknb-150knb150336knb-150
    • 2021-04-15
    155 min

    [MMYM-044]Y********l With Huge Tits Started Out Cutely Seducing Me But Gets Carried Away And Is Soon Screaming, Shaking, And Talking Dirty Mao Hamasaki

  • hamazaki mao censoredslutsingle workMMYMmarrionaida yumenoyumenoMMYM-044MMYM044mmym00044
    • 2021-04-23
    181 min

    [WAAA-051]If You Can Withstand Ai Mukai's Incredible Techniques, You'll Win Creampie Sex!

  • ai mukai censoredcreampieblowjobWAAAwanz factorywanzWAAA-051WAAA051waaa00051
    • 2021-04-28
    199 min

    [HHH-229]Wife Wearing Thong With Fixed Vibrator That She Cannot Take Off - We Pretend To Help Her And Fuck Her Right Away

  • censoredamateurHHHviptriple hHHH-229HHH22978hhh00229
    • 2021-05-08
    147 min

    [MKMP-397]It's A 360-Degree Titty Heaven!! They Only Love Me, And They'll Let Me Cum And Cum A Lot It's A Dream-Cum-True Polygamous Newlywed Sex Life Ruka Inaba Arisa Hanyu Nanami Matsumoto

  • nana matsumoto inaba censoredcreampiebig titsMKMPk m producerakudamillionMKMP-397MKMP397mkmp00397
    • 2021-05-20
    58 min

    229SCUTE-1116 Mikako (23) S-Cute Creampie in a shaved girl who makes H with a smile

  • amateur censoredcreampieamateurscutescute-1116scute1116229scute-1116
    • 2021-05-30
    61 min

    HEYZO 2535 Do Me A Favor？ Dangling Money In Front Of An Amateur Girl!! – Rui Minazuki

  • rui minazuki uncensoredcreampiehandjobheyzo
    • 2021-05-31
    145 min

    420POW-031 A * ne @ Reverse Bunny [Amateur Hoi Hoi power / Gonzo / Beautiful girl / Big breasts / Cum / J cup / Lotion oil / Cosplay / Glasses girls / Hidden masochist / 3 shots / Immediately Iki / Squirting / Amaenbo]

  • amateur censoredbig titsamateurpowpow-031pow031420pow-031
    • 2021-06-08
    64 min

    Caribbeancom 060821-001 I feel good at here -Exploring the erogenous zone and cum creampie sex- Maki Kozue

  • maki kozue uncensoredcreampiecaribbeancom
    • 2021-07-01
    244 min

    [AMBS-068]18 Barely Legal Girls Who Get Pranked By Their Families While They Are In The Bath

  • asuna koharu love sound censoredbeautiful girlAMBSplanet plusambibarentzAMBS-068AMBS068h-237ambs00068
    • 2021-07-02
    124 min

    [NKKD-216]Her Husband's Boss Is An Ass Lover... And He's Got His Eye On This Chaste Wife's Perky Booty Yu Shinoda

  • shinoda yu censoredbig titsmature womanNKKDjet eizoNKKD-216NKKD216nkkd00216
    • 2021-07-05
    85 min

    493NAEN-064 [Former entertainer] That junior model becomes J ○ K! ？？ Urara Kanon who rolls up with a grown-up mako

  • amateur censoredamateurbeautiful girlnaennaen-064naen064493naen-064
    • 2021-07-16
    46 min

    FFNN-078 Tokumei Kibo

  • amateur censoredcreampiebig titsffnnffnn-078ffnn078ffnn-078
    • 2021-07-18
    65 min

    421OCN-021 Mai-Chan (Mai Araki)

  • amateur censoredcreampieamateurocnocn-021ocn021421ocn-021
    • 2021-07-23
    94 min

    483SGK-034 [Shonan Bomb Iki Special 2nd] [Double G Big Breasts] [Transcendence Iki Roll] Shonan Bomb Iki Special 2nd Opening! !! The First Double G Huge Breasts Gal Combination Advent In The Series! Big Breasts, Swaying, Screaming, Smashing Cum! !! I

  • amateur censoredbig titssquirtingsgksgk-034sgk034483sgk-034
    • 2021-07-24
    57 min

    10musume 072421_01 Natural young wife : A 20-year-old mom before giving birth Karin Asanuma

  • amateur uncensored10musume
    • 2021-08-01
    122 min

    [NACR-443]Beautiful Tipsy Wife From Next Door "I"m home!" Miho Tono

  • miho tsuno censoredcreampieslutNACRplanet plusdirector oshichi ku ryuuNACR-443NACR443h-237nacr00443
    • 2021-08-10
    240 min

    [KTRA-321]Blowjob From A Beautiful Girl Who Looks At You Kate Live POV Blowjob: The BEST 4 Hours With Sixteen Girls

  • yui nagase toua kotone censoredblowjobbeautiful girlKTRAk tribeKTRA-321KTRA321h-094ktra00321
    • 2021-08-18
    32 min

    FC2PPV 2039969 Limited Number! !! [Uncensored] Fornication With A Beautiful Girl Reader Model With An Idol Face! Creampie In An Outstanding Slim Body! !!

  • amateur uncensoredfc2
    • 2021-09-04
    71 min

    200GANA-2548 Seriously Nampa, First Shot. 1684 If You Were Distributing Uchiwa For Free In Shibuya, You Succeeded In Picking Up A Baby-Faced Beautiful Girl JD! The Delicate Body Is Violently Embraced By The Big Cock Actor And Trembles With Pleasure!

  • amateur censoredamateurganagana-2548gana2548200gana-2548
    • 2021-09-07
    139 min

    [KMHRS-050]人一倍性欲強めな陰キャの人生が変わる時。初めての生チン、初めての中出し。のち、乱交。 本田のえる

  • honda noeru censoredbeautiful girlslutKMHRSsod createkaorukimihoreKMHRS-050KMHRS0501kmhrs00050
    • 2021-09-17
    118 min

    [MEYD-703]My Father-in-Law Gave Me A Quick Creampie While My Husband Went Out For A 5-minute Smoke Break. Ejaculating 10x Each Day For A Pregnancy. Hotaru Nogi

  • nogi firefly censoredcreampiebig titsMEYDtameike goromishima rokusaburoMEYD-703MEYD703meyd00703
    • 2021-09-25
    140 min

    [APAK-200]"I can"t, I"ll get pregnant!" New Secretary With Big Tits Couldn"t Refuse Hot Spring Trip For Creampie Cumshot Alice Nanase

  • alice nanase censoredcreampieslutAPAKaurora project annexrkAPAK-200APAK200apak00200
    • 2021-10-09
    151 min

    [CEMD-067]I Started My Personal Sex-Trade Shop! I Will Grant Whatever You Wish. Vol. 2, Mei Satsuki

  • satsuki mei censoredmature womansingle workCEMDserebu no tomoCEMD-067CEMD067cemd00067
    • 2021-10-16
    117 min

    [DDK-206]Female Pig Hut Female Livestock PLANT Otsu Alice

  • otsu alice censoredcreampiecosplayDDKdogmano maru kimDDK-206DDK206ddk00206
    • 2021-10-25
    61 min

    SIRO-4675 [First Shot] [Beautiful Leg Slender] [Ascension With Slamming Back] Excavated An Active JD Who Has Been Away From Sex For A Long Time And Has Sexual Desire. When An Imadoki Girl With A Serious Personality Immediately Screams With A Relentle

  • amateur censoredamateursirosiro-4675siro4675siro-4675
    • 2021-11-05
    232 min

    [TSP-448]Entrapped In Part-time Job. Girl Aiming To Be Craftsman "Shakes Her Pudding-Like Tits and Butt In Front of Me. How Can I Work？!"

  • censoredcreampieblowjobTSPtoukyou supesharugroupTSP-448TSP448tsp00448
    • 2021-11-07
    60 min

    [HEYZO-2653]Kyoko Moriguchi Nonstop Sexual Orgasm

  • amateur uncensoredcreampiehandjobheyzo
    • 2021-11-26
    73 min

    380SQB-129 Nozomi (Nozomi Komatsu)

  • amateur censoredcreampieamateursqbsqb-129sqb129380sqb-129
    • 2021-12-01
    69 min

    324SRTD-0259 Smile Is Too Best Wet Too Iki Too Cheating Woman And Creampie Sex

  • amateur censoredcreampiebig titssrtdsrtd-0259srtd0259324srtd-0259



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored