big 031




FC2AMBIATIDGMEMMILKAVSADASDMARASSNIMEYDFSDSSCESDSANMIDEHODVJULNACRIPXRBDNGODABW

2021-01-01
117 min

[NACR-387]Hold Me, Lover... I Fell In Love With The Single Mother Living Next Door Risa Mochizuki

  • risa mochizuki censoredcreampiemarried womanNACRplanet plusdirector oshichidomeNACR-387NACR387h-237nacr00387
    • 2021-01-09
    120 min

    [MEYD-644]My Friend's Mother - Ravished By Her Son's Friend, Made To Cum Over And Over... Shuri Yamaguchi

  • yuri yamaguchi censoredcreampiebig titsMEYDtameike gorohirokoji osakiMEYD-644MEYD644meyd00644
    • 2021-01-14
    88 min

    [ACZ-005]Livestock Collector Vol. 03 - Wild Masochist Female CEO Hinata

  • censoredamateurbdsmACZsanwa publishingabnormal.companiesACZ-005ACZ005h-019acz00005
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-16
    118 min

    [PPPD-898]My Girlfriend's Older Sister Tempted Me With Her Big Tits And Her Love Of Creampie Sex Nene Tanaka

  • nene tanaka censoredcreampiebig titsPPPDoppaiPPPD-898PPPD898pppd00898
    • 2021-01-20
    42 min

    FC2PPV 1652394 [No] [Limited to 100 pieces 1000pt OFF!] 2 consecutive vaginal cum shots for active idols ♥ ️ Shortcut slender loli beautiful girl ♥ ️ Complete appearance raw vaginal cum shot sex lifted! ♥ ️ * Review benefits / Gokkun Blow while elect

  • amateur uncensoredfc2
    • 2021-01-22
    240 min

    [YTR-151]Nene Takada Totally Drilled For 4 Hours

  • nene tanaka censoredcreampiebig titsYTRnonYTR-151YTR151h-127ytr00151
    • 2021-01-23
    64 min

    300NTK-506 Suddenly black GAL invades SEX! ？？ Make the god nice ass shiny and taste the black gal! !! On the contrary, the cheeky feeling increases the erection boost! !! Immediately insert SEX with continuous vaginal cum shot and think that it is a

  • galsex censoredcreampiesquirtingntkntk-506ntk506300ntk-506
    • 2021-01-24
    81 min

    FC2PPV 1656329 We will hold a special event during self-restraint! [No individual shooting, outflow, NTR] Because the subordinate of Decamar was inconvenient for SEX, I forced her to conceive in front of her and let her cum inside, so I was flirted w

  • amateur uncensoredfc2
    • 2021-01-29
    21 min

    FC2PPV 1664263 Limited to 3 days [Individual shooting] Prefectural general course ① 140 cm Reunited with an angel. Unauthorized first vaginal cum shot violently tampered with by two uncles

  • amateur uncensoredfc2
    • 2021-01-29
    43 min

    [per-361]ここみ

  • amateur censoredamateurperper-361per361per-361
    • 2021-02-03
    65 min

    [ion-074]二葉 2(26)

  • amateur censoredamateurionion-074ion074ion-074
    • 2021-02-12
    64 min

    10musume 021221_01 Amateur work: I’m a clerk at a shipping company Narumi Kawasaki

  • amateur uncensored10musume
    • 2021-02-18
    151 min

    [JJBK-040]MILFs Only - Hidden Camera Voyeur Footage Of Mature Sluts Taken Home To Fuck - Then Sold As Porn 38 - Cougar Thirsty For Young Cock Moans As She Gets Plowed Edition - Ms Sachiko, G-Cup, Age 40, 5Ɗ", Sexy Tanned Nympho, Ms Toshimi,

  • censoredmature womanJJBKjukujo bank emmanuellemanji groupJJBK-040JJBK040jjbk00040
    • 2021-02-18
    119 min

    [SSNI-999]Sexy Costume Non-Nude Erotica Star Akua Yamazaki Can't Resist Her Gropers... Barely Legal Teen Ravished In 5 Situations

  • mizuyama yamazaki censoredbig titsbeautiful girlSSNIs1 no 1 stylekyoseiSSNI-999SSNI999ssni00999
    • 2021-02-27
    181 min

    [WAAA-034]If You Can Withstand Ai Sayama's Amazing Technique, You Can Have Raw Creampie SEX With Her!

  • sayama love censoredcreampieslutWAAAwanz factorywanzWAAA-034WAAA034waaa00034
    • 2021-02-28
    103 min

    [SOAV-074]A Married Woman's Infidelity - Nono Yuki

  • yuki s censoredsingle workSOAVhitozuma engokai emmanuelleihyo kairoiSOAV-074SOAV074soav00074
    • 2021-03-19
    63 min

    FC2PPV 1694498 [Limited quantity 2980pt → 1980pt] Legendary Pukuman ❤️ Active cosmetic surgery esthetician Kaho who was deceived by massage recruitment ❤️ Plump and thick Oma ○ This is a permanent preservation version Many purchase benefits

  • amateur uncensoredfc2
    • 2021-03-26
    240 min

    [OKAX-717]If You Get An Old Lady To Your Room, She's Down To Fuck 4 Hours

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-717OKAX71784okax00717
    • 2021-03-28
    58 min

    [490FAND2-1]れん 1

  • amateur censoredbig titsamateurfand2fand2-1fand21490fand2-1
    • 2021-03-28
    38 min

    [490FAND1-4]ねね 4

  • amateur censoredbig titsamateurfand1fand1-4fand14490fand1-4
    • 2021-04-09
    119 min

    [MIAA-422]The Girls I Work With Missed The Last Train Home So I Invited Them Over. Normally They're Well-Behaved, But Tonight They Go Wild And Start Pleading For My Seed Runa Tsukino Mikako Abe

  • tsukino luna abe mikako censoredslutMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-422MIAA422miaa00422
    • 2021-04-11
    30 min

    FC2PPV 1764394 [3P Orgy] [Snow Skin / Snow Breasts] 20-year-old JD who both parents lost their jobs and had to expose their beautiful skin to earn school fees. In her first orgy in her life, she holds two cocks in her upper and lower mouths

  • amateur uncensoredfc2
    • 2021-04-17
    120 min

    [JUL-540]Rare Gem - Mrs Diamond Exclusives Part 4! Her First Adultery! "I'm Off To My Class Reunion," She Says, And Three Hours Later She's Already Fucked. Hitomi Honda

  • honda hitomi censoredmature womansingle workJULmadonnaJUL-540JUL540jul00540
    • 2021-05-07
    126 min

    [IENF-141]Immediate Nipple Orgasm! Woman With Big Sensitive Tits Tries Dry Humping! No Matter How Many Times She Cums, The Relentless Piston Fucking Won't Stop Until She's Been Filled With Cum!!

  • takarada monami rin hayama censoredcreampiebig titsIENFienergytiger kosakaiienfIENF-141IENF1411ienf00141
    • 2021-05-11
    62 min

    499NDH-016 An exotic beauty therapist with a neat appearance and more than 3 digits of experience pulls out all the sperm of a virgin! Blow, vagina, raw vaginal cum shot! The number of experienced people is not bad! Gently … sometimes violently

  • amateur censoredcreampieamateurndhndh-016ndh016499ndh-016
    • 2021-05-15
    126 min

    [TIKB-109]Video Records Of A Perverted Older Man The Feel Of Sexy Asses Nontan Kanon Ibuki

  • kanobuki censoredbig titssingle workTIKBtikitiki.comerTIKB-109TIKB109tikb00109
    • 2021-05-17
    88 min

    FC2PPV 1809270 [Individual] G cup beautiful wife 35 years old, Gonzo sex that is covered with oil at the hotel and is squid by a young man who is one or more lower [First special price]

  • amateur uncensoredfc2
    • 2021-05-22
    131 min

    [KATU-082]Slutty Pub Owner With Erect Nipples Plump Nympho Amazon Goddess With Huge Tits And Ass

  • censoredbig titsslutKATUkatsuo bussan mousouzokumaglowKATU-082KATU082katu00082
    • 2021-05-28
    107 min

    [YST-245]I Don't Care Whether It's Classy Or Dirty, I Just Want To Be Fucked By Miss Honma Until It Blows Yuri Honma

  • really censoredcreampiebig titsYSTkomyoYST-245YST245540yst00245
    • 2021-05-28
    56 min

    FC2PPV 1841342 * Monthly limited 2980⇒1980pt ★ First shot ☆ Rainy day married woman! A beautiful mom with a child gets a vaginal cum shot with another stick ♥ Sakura’s 23 years old ☆ Electric Maiki ♥ Intense cancer thrusting bicubic faint in ago

  • amateur uncensoredfc2
    • 2021-06-15
    81 min

    [PPMNB-108]Being Cute Is Not Enough! Natsuki

  • censoredbig titsbeautiful girlPPMNBcranePPMNB-108PPMNB108h-706ppmnb00108
    • 2021-06-15
    58 min

    [061521_001]親友の彼女 立花かおり

  • amateur uncensored1pondo
    • 2021-06-16
    155 min

    [DVDMS-679]This Hotel Cleaning Lady Was Wearing Some Tight Ass Pants, And I Could No Longer Resist, So I Shoved My Big Dick In From Behind And Got Myself A Quickie! "But I Have A Husband ..." She Tried To Protest, But This Manly Male Guest Ma

  • censoredamateurDVDMSdeep sswing nagaseDVDMS-679DVDMS679dvdms00679
    • 2021-06-18
    36 min

    FC2PPV 1874485 Limited number [Uncensored] Road to a longing voice actor … Reality a few months after that … Creampie in big breasts of anime voice! !!

  • amateur uncensoredfc2
    • 2021-06-18
    115 min

    [PARATHD-3198]I Found Out My Female Boss At Work Is Secretly An Escort And Convincing Her To Have Sex - Highlights

  • censoredbig titsamateurPARATHDparadise tvPARATHD-3198PARATHD3198parathd03198
    • 2021-06-20
    135 min

    [GENM-083]Challenge to Attack! Instructions And Pleasure Techniques From A Masochistic Man - With Kira Tsukishiro

  • tsukishiro kira censoredhandjobsingle workGENMgenekigoldfish dGENM-083GENM083genm00083
    • 2021-06-26
    151 min

    [LULU-077]Her Husband Was Out, So It Was Just The Two Of Us - I Couldn't Resist My Step-Aunt's Big Booty While She Was Cleaning, And Ended Up Pounding It Right To A Creampie. Ai Mukai

  • ai mukai censoredcreampiesingle workLULUlunaticsluminaxLULU-077LULU077lulu00077
    • 2021-06-29
    198 min

    496SKIV-008 Atsuko-chan 2 (22)

  • amateur censoredamateurskivskiv-008skiv008496skiv-008
    • 2021-06-30
    62 min

    444KING-041 Madoka

  • amateur censoredcreampiebig titskingking-041king041444king-041
    • 2021-07-06
    46 min

    188HINT-0466 Yuki

  • amateur censoredcreampiesquirtinghinthint-0466hint0466188hint-0466
    • 2021-07-17
    120 min

    [JUL-661]"I'm Serious, You Only Get To Stick In The First 3cm, Okay ...？" When I Met My C***dhood Friend For The First Time In Years, We Started Messing Around From The Get Go, And We Spent A Week Becoming More Than Friends, But Not Quite

  • shinoda yu censoredcreampiebig titsJULmadonnarokusaburo mishimaJUL-661JUL661jul00661
    • 2021-08-04
    40 min

    10musume 080421_01 Got introduced to an amateur girl who has a lot of SEX friends Mai Maruyama

  • amateur uncensored10musume
    • 2021-09-06
    69 min

    FC2PPV 2158392 Active Third Grader Of Fair-Skinned Beautiful Milk E Cup. Although She Is A Small Animal Raised In The Countryside, A Large Amount Of Love Juice Overflows From Her Vagina. She Secretly Half Vaginal Cum Shot While Watching The Swaying B

  • amateur uncensoredfc2
    • 2021-09-13
    58 min

    328HMDN-407 [Individual, 60th Road] Big Breasts Sexual Intercourse With G Cup Mother’s Sister. Gonzo Out Her Aunt Who Had Been Getting Nui From The Dc Era

  • amateur censoredcreampiemarried womanhmdnhmdn-407hmdn407328hmdn-407
    • 2021-09-22
    100 min

    355OPCYN-179 Sakura

  • amateur censoredbig titsamateuropcynopcyn-179opcyn179355opcyn-179
    • 2021-09-25
    239 min

    [NASH-579]The Adulterous Sex Of 30 Mature Women From The Showa Era - 50 And 60-something Wives Who Want To Be Fucked

  • censoredmature womanNASHnadeshikoitou hajimeNASH-579NASH579nash00579
    • 2021-10-01
    122 min

    [MARA-061]Miu Arioka"s Colossal Tits, Theater, I-Cup! 96 cm

  • arioka miu censoredcreampiebig titsMARAplanet plusdirector omarakasuMARA-061MARA061h-237mara00061
    • 2021-10-14
    58 min

    285ENDX-365 Aza And Erotic And Bitch Cute Waist Goddess

  • amateur censoredcreampieamateurendxendx-365endx365285endx-365
    • 2021-10-16
    131 min

    [ONSG-043]A Whore With Big Tits, Nenne Ui

  • first love censoredcreampiebig titsONSGgeinko pore shongain corporationONSG-043ONSG043onsg00043
    • 2021-10-20
    89 min

    [SPZ-1117]どこまでヤレる！？メンズエステのムチ尻お姉さん

  • censoredbig titsSPZstar paradisesuta paradaisuSPZ-1117SPZ1117h-254spz01117
    • 2021-11-02
    74 min

    534IND-007 Blow Job Declaration Of Mouth Skills Masashi Beauty Enmitsu Cum Inside Video Leaked! !!

  • amateur censoredcreampiebig titsindind-007ind007534ind-007
    • 2021-11-30
    120 min

    [SAN-028]Intense Taking Advantage Of! Rough Sex. Female Divorcee Working At Massage Parlor Is Turned Into Sex Toy For Clients. Victim No. 001. Miki Maeshima

  • miki maejima censoredsingle workSANmazakisakura kabinmother mazaSAN-028SAN028h-796san00028
    • 2021-12-09
    222 min

    [SW-815]Marital Swapping Swapping! A Wanton Wife Gets Off On Another Husband"s Dick In Front Of Her Husband"s Eyes.

  • censoredblowjobSWswitchyocchanswitch hibinoSW-815SW8151sw00815
    • 2021-12-18
    115 min

    [NCYF-014]Crazy 8-person Orgy! Short Height 140m 18 Year Old Beautiful Girl In Elf Cosplay. Barely Legal With A Pure White Body For Intense Amateur Photo Group Session "That"s Enough, I"m Cumming!" (Bent Over To Get Fucked For A Craze

  • censoredcreampiecosplayNCYFall japan amateur photographers union daydream fantasy loversudagawaNCYF-014NCYF014ncyf00014
    • 2022-01-01
    142 min

    [AVSA-188]SUPER FISHEYE FETISHISM Intense And Exciting Close-up Shots. Lewd Cosplay On A Lustful Body. Hana Himesaki

  • himesaki hana censoredbig titscosplayAVSAavs collector sbuddha davscollector sAVSA-188AVSA188avsa00188



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored