big 116




FC2IPXSANVENXAMBISQTEAUKGHNDDTTGMEMSSISMEYDAWDAVSANACRKBINACXSTARSVEMAGVHVENU

2020-09-19
97 min

390JAC-059 [God milk god butt x ultimate beauty x vaginal cum shot 3 barrage] This guy has appeared! I’m so excited! Big ~ Big in milk ~ Butt! Orapafupafusunzo! Bikkun Bikkun convulsions! Igg Igg Climax! It’s over with this guy Creampie Sad

  • amateur censoredcreampiebig titsjacjac-059jac059390jac-059
    • 2020-09-24
    97 min

    [KAAD-047]My Beautiful Mother-in-law - Ryo Fukutomi

  • ryo fukutomi censoredcreampiemature womanKAADcenter villagedaichi minamihona zonoKAAD-047KAAD047h-086kaad00047
    • 2020-10-03
    112 min

    390JAC-062 [* Browsing attention * Brain alive metamorphosis JD x 4 vaginal cum shot] Ultimate different dimension FUCK Bomb here! Whole body clitoris college student gets acme and spree! Iku with word blame! Iku with air nipple licking! Iku with sig

  • amateur censoredcreampieamateurjacjac-062jac062390jac-062
    • 2020-10-16
    483 min

    [PPT-100]Non Nonoura 8 Hours BEST PRESTIGE PREMIUM TREASURE Vol.02 All 6 Videos + Previously Unreleased Videos To Track The Career Path Of Non Nonoura, In This Collector's Edition!!

  • nonoura warm censoredcosplaysingle workPPTprestigeno directorprestige premium treasurePPT-100PPT100118ppt00100
    • 2020-10-24
    40 min

    H4610 ki201025 Megumi Shirakawa 29years old

  • amateur uncensoredh4610
    • 2020-11-06
    60 min

    Caribbeancom 110620-001 Dynamite: Hasumi Yoshioka

  • amateur uncensoredcreampiehandjobcaribbeancom
    • 2020-11-12
    124 min

    [FSDSS-122]Immediate Challenge During A Gravure Shot With No Adult Actions Allowed - Moe Tenshi

  • angel moe censoredblowjobbeautiful girlFSDSSfalenotake dfaleno starFSDSS-122FSDSS1221fsdss00122
    • 2020-11-13
    117 min

    [DASD-754]Amy Fukada Gets Possessed By A Dirty Old Man He Took Over This Girl With Light Skin And Big TIts, And Fucked Her Boyfriend In Her Body

  • emi fukada censoredbig titssingle workDASDdasrokusaburo mishimaDASD-754DASD754dasd00754
    • 2020-11-29
    160 min

    [LULU-048]My Convenient Big Ass Pet Who Loves Me Too Much She Looks Cute But Her Pussy Is A Crude And Rude Fucking Machine Because This Obedient Maso Bitch Will Scream And Shout And Go Insane With Orgasmic Pleasure! Kanae Kawahara

  • kanae kawahara censoredcreampiesingle workLULUlunaticsluminaxLULU-048LULU048lulu00048
    • 2020-12-23
    14 min

    S-Cute 807_nico_03 Seriously naughty vertical shooting cowgirl / Nico

  • nico censoredamateurniconico-03nico03807-nico-03
    • 2020-12-25
    47 min

    416SVMM-038 Mirei

  • amateur censoredcreampiesquirtingsvmmsvmm-038svmm038416svmm-038
    • 2021-01-21
    168 min

    [SVDVD-837]We Challenged An Underwear Model With Big Tits To Non-Stop Nipple Play! With The Tips Of Her Sensitive Breasts Thoroughly Stimulated, She Has Her First-Ever Squirting Orgasm! And Then Is So Horny She Wants To Be Pounded - And Take A Creamp

  • censoredcreampiebig titsSVDVDsadistic villagesushi yokuboSVDVD-837SVDVD8371svdvd00837
    • 2021-01-27
    122 min

    496SKIV-002 Yuki who loves cum 2

  • amateur censoredamateurskivskiv-002skiv002496skiv-002
    • 2021-01-30
    54 min

    [HHKL-082]Angel In White Vacuums Up Every Drop Of Her Patients Seed With Tight Pussy Cowgirl Nene Tanaka

  • nene tanaka censoredbig titsblowjobHHKLhuntervolvo nakanohhh groupHHKL-082HHKL082hhkl00082
    • 2021-02-16
    110 min

    [MXGS-1172]Giving A Quickie To Rina Takase , A Cute Girl With Huge F-cup Tits Whose Long Black Hair Looks Good On Her

  • rina takase censoredbeautiful girlsingle workMXGSmaxingMXGS-1172MXGS1172h-068mxgs01172
    • 2021-02-25
    71 min

    [SIROR-051]The Work Of A Mature Woman For Rent - Wives' Secret Faces, Unknown To Their Husbands, File NO. 51 -

  • censoredcreampiebig titsSIRORdispatched.comSIROR-051SIROR051h-1492siror00051
    • 2021-03-02
    124 min

    [ARM-957]I'll Put An Egg Vibrator In My Panties, So Look When I Touch Myself, Alright？

  • kasagi ichika sunflower censoredbeautiful girlARMaroma kikakuhamu oujiaromaARM-957ARM957arm00957
    • 2021-03-07
    90 min

    NIQN-001 Nozomi

  • amateur censoredcreampiebig titsniqnniqn-001niqn001niqn-001
    • 2021-03-13
    121 min

    [DASD-829]This Bushy Bush Barely Legal Babe Was Pumped With Impregnating Piston-Pounding Thrusts, Over And Over Again, By A Stranger In The Dark Asuka Momose

  • momose asuka censoredcreampieuniformDASDdaschinpo dazaiDASD-829DASD829dasd00829
    • 2021-03-14
    39 min

    FC2PPV 1726590 Squirting sex from Deep Throating by grasping the weakness of a slender half beauty and bringing it to the hotel and forcibly sucking the cock [Amateur individual shooting original ZIP available]

  • amateur uncensoredfc2
    • 2021-03-17
    12 min

    FC2PPV 1699831 [Personal shooting] Hiromi 41 years old Short SEX remastered version [Limited time offer]

  • amateur uncensoredfc2
    • 2021-04-09
    20 min

    FC2PPV 1762008 [Uncensored] Half-model-class beautiful girl J ● Miss Refre Mai-chan’s top secret back byte !! Mai-chan (18 years old)

  • amateur uncensoredfc2
    • 2021-04-10
    132 min

    [APOD-048]Urara Is A Girl With A Big Ass And A Wild Orgasm Face Who Loves Cock And Seducing Men On Hookup Apps

  • censoredamateurAPODapollo daydreamersapollo apollo daydreamersAPOD-048APOD048apod00048
    • 2021-04-16
    96 min

    FC2PPV 1773250 [3980 → Weekend limited 1980] Legal Lolita 18 years old ❤️ Around the age of being curious about eroticism ❤️ Continuous acme with doubling sensitivity ❤️ Climbing the stairs of adults at once ❤️ JD entrance examination stress release

  • amateur uncensoredfc2
    • 2021-04-27
    31 min

    490FAN-047 Yumi

  • amateur censoredcreampieamateurfanfan-047fan047490fan-047
    • 2021-04-27
    51 min

    H0930 ki210427 Yuko Tominaga 31years old

  • amateur uncensoredh0930
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-29
    112 min

    [IRO-044]Married Woman Groping Train ~ Fifty Year Old Mother Gets Ravished ~ Makiko Tsurugawa

  • makiko tsurukawa censoredcreampiemarried womanIROcenter villagesouthern earthzora center villageIRO-044IRO044h-086iro00044
    • 2021-05-18
    60 min

    299EWDX-359 De Nasty Wife Who Enjoys SEX Despite Being Astringent

  • amateur censoredmarried womanamateurewdxewdx-359ewdx359299ewdx-359
    • 2021-05-26
    120 min

    [C-2640]My Wife's Friend Was Going To Spend The Night At Our Place "Her Name Is Misuzu-san (Not Her Real Name), She's A Married Woman, 30 Years Old" So Naturally, I Took Advantage Of The SItuation

  • censoredmarried womanamateurCgogoskoichi takahashicore gogo sC-2640C2640
    • 2021-06-24
    156 min

    [NTRD-092]Cuckolders: She Slept With My Employee... Sakura Tsukishima

  • tsukishima sakura censoredsingle workNTRDtakara eizokouji takarashintokaiNTRD-092NTRD09218ntrd00092
    • 2021-07-10
    240 min

    [NASH-534]Stepmother's Temptation: "Keep It a Secret from Stepfather" A Stepmother in her 50s Greedily Sucks Her Stepson's Dick without Telling her Husband 4 Hours 14 People

  • censoredcreampiebig titsNASHnadeshikoNASH-534NASH534nash00534
    • 2021-07-15
    55 min

    481SACZ-050 Hitomi 2

  • amateur censoredamateurbdsmsaczsacz-050sacz050481sacz-050
    • 2021-07-18
    241 min

    [NASH-545]The Fleshy Mature Woman Whose Voluptuous Body I Want To Grab. The BEST 14 Persons.

  • anmizuki aya takashiro censoredbig titsmature womanNASHnadeshikoNASH-545NASH545nash00545
    • 2021-07-18
    243 min

    [NASH-543]Real Sexy Stories 23

  • uno sakina abe sakina mitani akari censoredNASHnadeshikoNASH-543NASH543nash00543
    • 2021-07-30
    117 min

    [JUL-664]A Record Of The Three Days I Spent In My Hometown Making Love To The Classmate I Loved - Ryo Aiyo

  • ayumi ryo censoredbig titsmature womanJULmadonnaasagiri jouJUL-664JUL664jul00664
    • 2021-07-31
    239 min

    [MLSM-049]S Class Mature Woman Best Of Reiko Kobayakawa 4 Hours Big Tits And Nice Ass Madonna

  • kobayakawa reiko censoredcreampiebig titsMLSMmellow moonMLSM-049MLSM049mlsm00049
    • 2021-09-29
    60 min

    318LADY-386 Oranges

  • amateur censoredbig titsamateurladylady-386lady386318lady-386
    • 2021-09-30
    59 min

    355OPCYN-189 Misuzu (Kashii Misuzu)

  • amateur censoredcreampieamateuropcynopcyn-189opcyn189355opcyn-189
    • 2021-10-01
    120 min

    [NACR-466]In a Daydream about A Son"s Wife... Kaho Imai

  • natsuho imai censoredcreampiebig titsNACRplanet plussakura ninshichi ku ryuuNACR-466NACR466h-237nacr00466
    • 2021-10-18
    70 min

    [SOMX-001]Take Love on Night at Hot Springs That Was Kept Secret From My Parents. Fuck As Much As I Like With Horny Girlfriend Who Wants Me In The Bath And the Room. Arisu Mizushima

  • amateur censoredSOMXorustak softSOMX-001SOMX001
    • 2021-10-22
    117 min

    [OPKT-031]Forbidden Pregnancy Creampie Allowed At Work, Chisato Mochizuki

  • chisato mochizuki censoredcreampiebig titsOPKTtoyohikotoyohikotoyohiko kikakuOPKT-031OPKT031opkt00031
    • 2021-10-26
    54 min

    [498DDH-040]「これもマッサージですから♪」仕事熱心なエステティシャンの行き過ぎサービスでイキ過ぎ連続射精！

  • amateur censoredcreampiebig titsddhddh-040ddh040498ddh-040
    • 2021-11-05
    160 min

    [JUL-760]An I-cup Married Woman Who Is Just So Obedient, Begging With Moist Eyes. Yu Shirato, 28 Years Old, AV DEBUT

  • censoredbig titsmature womanJULmadonnamamezawa mametarouJUL-760JUL760jul00760
    • 2021-11-06
    62 min

    355OPCYN-194 Misuzu 2 (Kashii Misuzu)

  • amateur censoredamateuropcynopcyn-194opcyn194355opcyn-194
    • 2021-11-12
    60 min

    [FTHT-049](Would You Please Watch While I Engage In Masturbation？ 01) What？？ You Said All I Had To Do Was Watch! Video Content Filled With Petite Fetishes On FALENO TUBE

  • censoredbig titshandjobFTHTfaleno tubedavielFTHT-049FTHT0491ftht00049
    • 2021-11-12
    150 min

    [MIAA-533]A Slut Gal Gives A Mad Blowjob And Is Cum Swallowing My Sperm, But The Problem Is That I"m Her Homeroom Teacher "Hey Teacher, I"ll Make Your Cock Sing Like An Idiot" Himari Kinoshita Iroha Isshiki

  • himari kinoshita himari hanazawa isshiki ayaba censoredcreampieblowjobMIAAmoodyzkindaichishougo rouminna no kikatanMIAA-533MIAA533miaa00533
    • 2021-11-20
    241 min

    [MDBK-209]BAZOOKA LEGENDARY ACTRESS Asahi Mizuno PREMIUM BEST

  • mizuno chaoyang censoredcreampiebig titsMDBKbazookak taroMDBK-209MDBK209mdbk00209
    • 2021-11-25
    180 min

    [SDAB-204]生徒会長はくびれ巨乳 久里くらら SOD専属AVデビュー

  • kuri kurara censoredbig titsSDABsod createmasaki naoseishun jidaiSDAB-204SDAB204
    • 2021-11-26
    44 min

    FC2PPV 2467232 [Translated Ant Special Price] [Appearance Available] [Caution For Deletion] The Translated Ant Has Been Stored, But Will Be Released. Nameless ○ Li Girl’S Creampie Sex

  • amateur uncensoredfc2
    • 2021-11-29
    74 min

    328HMDN-431 [Beautiful Housekeeper Who Is A Hot Topic On TV] Leaked Video. Private Sex Shooting With A Young Model Without Telling Her Husband And Vaginal Cum Shot (Saran Ito)

  • amateur censoredcreampiemarried womanhmdnhmdn-431hmdn431328hmdn-431
    • 2021-12-03
    240 min

    [DVDMS-744]Ordinary Men And Women Monitoring AV - Magic Mirror Service Collaboration Variety. Amateur S*********ls Put On Black Tights And Keep Them On For A First-time Squirting Orgasm Experience! A Crowd Of Girls Heading In Black Tights Coming Home

  • censoredsquirtingschoolgirlDVDMSdeepspoolsideDVDMS-744DVDMS744dvdms00744
    • 2021-12-07
    20 min

    FC2PPV 2497205 A Slim Young Wife Who Strips Her White Eyes With A Stick And Cums. She Was Raped On Behalf Of Her Multi-Debt Husband In A Happy House

  • amateur uncensoredfc2
    • 2021-12-09
    117 min

    [NHDTB-608]After Resisting And Pulling Out Just Before A Creampie, This Dick Fucks Her Like Crazy Non-stop While She Gets Her Hips Held Tightly For A Cum Load Deep Inside.

  • censoredcreampiedeepthroatNHDTBnatural highjanken kotamaNHDTB-608NHDTB6081nhdtb00608
    • 2021-12-09
    158 min

    [SW-816]I Always Loved You. I Wish You Would Have Told Me That Sooner ... After Getting Married, She Was Hooked On The Temptation Of Committing Adultery With Her Colleague, And During A Business Trip, When They Were Booked Into The Same Room, They Fu

  • kinoshita ayame censoredblowjobsingle workSWswitchraito fuji makotoswitch hibinoSW-816SW8161sw00816
    • 2021-12-11
    122 min

    [NKHB-012]Chubby Ms. Ishihara from Wakayama. Eiko. B119 W130 H110 110

  • censoredbig titsamateurNKHBthe thick and meaty cafeteria the daydream tribeNKHB-012NKHB012nkhb00012



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored