big butt jav high visio censored javcensored




FC2JUFEDTTMEYDPPPDSSISSSNIMARASQTECESDDASDAMBIJULHNDAUKGGMEMMIDVHMNWANZADNCAWD

2020-10-04
135 min

[DNJR-037]Dirty Talk Is This Wild Busty Broadcaster Prof's Specialty, And There's Nothing She Loves More Than Teasing Guys Nipples Chihaya Akimoto

  • akimoto chihaya censoredslutsingle workDNJRdog daydreamersmaboroshikoDNJR-037DNJR037dnjr00037
    • 2020-10-10
    55 min

    C0930 ki201011 Mari Inui 41years old

  • amateur uncensoredc0930
    • 2020-10-27
    152 min

    [HONB-193]Don't Look At Me! I'm Going To Cum! Beauty Parlor S*****t (# ^^ #)

  • censoredcreampieHONBmercurythe first shibuya special f e headquarHONB-193HONB193h-1133honb00193
    • 2020-10-31
    145 min

    [MIDE-844]My Favorite Pop Star Betrayed Me, So I Gave Her What Was Coming To Her: My Cock -Super Fan Gone Bad Films His Revenge Sex- Sora Minamino

  • minano sora censoredbeautiful girlsingle workMIDEmoodyzoosaki hirokoujimoodyz divaMIDE-844MIDE844mide00844
    • 2020-11-12
    116 min

    [NINE-041]A Famous Slut Is Wandering Around Picking Up Guys On The Street With Her Colossal Tits And Cellulite-filled Giant Ass *Hot Pants Widow Towako (35 Years Old)

  • censoredbig titsamateurNINEmercurybrisketchateaubriand hutNINE-041NINE041h-1133nine00041
    • 2020-11-13
    52 min

    [NTTR-054]A Predatory Player Who Likes To Go On The Hunt Has Possessed Asumi Yoshioka's Body! When Her Boss Came Over To Check On Her, He Used Her Body To Fuck His Brains Out, And Got So Hooked On Female Sensuality, He Started Cumming Like Crazy!

  • yoshioka asuka censoredbig titsNTTRsod createben katoknotriNTTR-054NTTR0541nttr00054
    • 2020-11-18
    79 min

    259LUXU-1346 Luxury TV 1328 [The secret of a beautiful wife …] An elegant and graceful married woman suddenly changes! Begging with tears, “Please let me go”! The horny body that gradually became honest with desire is enthusiastic abou

  • amateur censoredamateurmature womanluxuluxu-1346luxu1346259luxu-1346
    • 2020-11-22
    59 min

    413INST-072 Everyone’s masochist toilet Emika Chan ♪ 3P orgy ☆ De M-chan shows her true character! Masochist pussy entwined with the thrill of vaginal cum shot ♪ stakeout FUCK that cums for each piston Iki broken seeding SEX

  • amateur censoredcreampieamateurinstinst-072inst072413inst-072
    • 2020-12-10
    62 min

    [orex-178]せなちゃん 2

  • amateur censoredcreampieschoolgirlorexorex-178orex178orex-178
    • 2020-12-18
    481 min

    [MBM-245]These Videos Have Hit Record-Breaking Sales Numbers On A Streaming Site The Legendary Mature Woman Seducer Divine Videos 36 Ladies 8 Hours Amazing Best Hits Collection

  • censoredamateurmature womanMBMprestigegaro sasazukambmMBM-245MBM245118mbm00245
    • 2020-12-20
    63 min

    413INST-080 [Gravure production outflow] Top secret personal photo session with that topical gravure idol

  • amateur censoredcreampiebig titsinstinst-080inst080413inst-080
    • 2020-12-22
    122 min

    [SDNM-257]She Works Hard At Her Job And To Keep Her Family Together, But She's Also Got Twice The Lust Of The Average Woman Hikaru Konishi 29 Years Old Chapter 2 "My Husband Is Coming Home From His Posting." Within The Limited Time She�

  • hikaru konishi censoredmature womansingle workSDNMsod createakira saijogenuine married woman the porn experienSDNM-257SDNM2571sdnm00257
    • 2020-12-28
    54 min

    FC2PPV 1612940 Mosaic collapsed version ❤️ A hostess who goes crazy with abstinence for 2 weeks is seriously dying of sexual desire ❤️ A bitch who sucks on her husband’s Ji ○ port with an ahegao

  • amateur uncensoredfc2
    • 2021-01-10
    301 min

    [DVAJ-495]Beautiful Women Wearing Black Pantyhose BEST 5 Hours

  • tsukasa aoi yui hatano censoredDVAJalice japansagi kandaDVAJ-495DVAJ495dvaj00495
    • 2021-01-22
    139 min

    [BFD-005]The Girl I Like Is Dating My Best Friend Rei Kuruki

  • satoshi kuruki censoreduniformschoolgirlBFDdream ticketikkyu senBFD-005BFD00524bfd00005
    • 2021-01-30
    186 min

    [WAAA-027]If You Can Endure Rika Aimi`s Awesome Techniques You Can Have Creampie SEX With Her!

  • rumi tadami censoredcreampiebig titsWAAAwanz factorywanzWAAA-027WAAA027waaa00027
    • 2021-02-05
    92 min

    [hoi-159]アイchan(23)

  • amateur censoredbig titsamateurhoihoi-159hoi159hoi-159
    • 2021-02-13
    114 min

    [APNS-226]I Get Excited Being In Group Sex While You Look At Me... Rui Miura

  • rui miura censoredcreampiebig titsAPNSaurora project annexyukihiro nasuaurora project anexAPNS-226APNS226apns00226
    • 2021-02-22
    178 min

    [WNSK-002]After This, Will She Immediately Commit Infidelity!？ When I Saw My Girlfriend Defiled With Another Man's Semen, I Had A Melancholic Erection!!

  • censoredWNSKoneWNSK-002WNSK002wnsk00002
    • 2021-02-24
    81 min

    FC2PPV 1699907 [Personal shooting / set sale] The full version of the wife who will be the victim of her husband’s winter bonus being cut significantly

  • amateur uncensoredfc2
    • 2021-02-26
    48 min

    [MASE-015]Horny Older Women 33 Year Old Hotaru Big Mature H Cup Titties And Curvy Body Arching Backs And Raw Fucking! Hotaru Mori

  • hotaru mori censoredcreampiebig titsMASEcrystal picturemadam maniac plusMASE-015MASE01549mase00015
    • 2021-03-01
    120 min

    [NACR-401]Tying Up A Masochistic Married Woman And Making Her Cum During Sex - Mia Hazaki

  • mia hasaki censoredbig titsbdsmNACRplanetshichidomeNACR-401NACR401h-237nacr00401
    • 2021-03-22
    102 min

    [NSPS-978]The Boss And His Wife Underling 14 - My Boss Took Advantage Of My Wife's Body - Saryu Usui

  • sakisui censoredmature womansingle workNSPSnagae stylenagaeNSPS-978NSPS978nsps00978
    • 2021-03-25
    125 min

    [JRZE-037]First Time Filming My Affair - Nanako Agawa

  • nanako agawa censoredcreampiemature womanJRZEcenter villagejiro fukagawajurakuJRZE-037JRZE037h-086jrze00037
    • 2021-04-02
    150 min

    [JUL-528]Glamorous + Elegant Unbelievably Hot Married Woman With I-Cup Tits Kyoko Ichikawa 40 Years Old Porn Debut!

  • kyoko ichikawa censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-528JUL528jul00528
    • 2021-04-08
    108 min

    [SPRD-1396]Forgive Me... I Want My Son-In-Law So Get Me Pregnant - Honoka Nakayama

  • hoka nakayama censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1396SPRD139618sprd01396
    • 2021-04-09
    140 min

    [SKEJ-008]Moaning With Ecstasy! Beautiful Girl Gets Pounded Hard By Huge Cock!

  • censoredamateurbeautiful girlSKEJamateur time delusion groupSKEJ-008SKEJ008skej00008
    • 2021-04-11
    61 min

    FC2PPV 1764902 Super erotic] Nursery teacher 25 years old [Boyfriend ant] A beautiful woman who transforms from a gentle face in the daytime and sticks out a man’s ass hole at night

  • amateur uncensoredfc2
    • 2021-04-15
    123 min

    [KAGP-180]Pussy And Anus On Display Super Close Up Videos Of Amateur Girls Masturbating 12 Girls

  • censoredamateurbeautiful girlKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-180KAGP180kagp00180
    • 2021-04-18
    119 min

    [NSPS-986]Do You Believe Your Wife？ The Cuckhold Test Satomi Suzuki

  • satomi suzuki censoredmature womansingle workNSPSnagae stylenagaeNSPS-986NSPS986nsps00986
    • 2021-04-22
    255 min

    [SVDVD-853]One-Way Mirror Cab: Hard-Boiled - These S********l Tik Tok-ers From The Country Can Win Travel Expenses And Prize Money After Being Stuck At Home Without Field Trips Or Even Graduation Ceremonies Due To Social Distancing - Now That It'

  • censoredcreampiesquirtingSVDVDsadistic villagenew kazi kazamamagic mirror sadistic villageSVDVD-853SVDVD8531svdvd00853
    • 2021-04-25
    34 min

    FC2PPV 1786137 Sale until 5/8! (No) [SM / Turn a woman into an onaho] Prepare to delete! Re-educate the Mase J.K captured with the matching app with a full-head mask! Meat Onaho Creampie! See the end-of-life drama posted on SNS for foolery [Add foole

  • amateur uncensoredfc2
    • 2021-04-29
    74 min

    476MLA-036 [Back customs x slimy god massage] Narrow vagina slender beauty squeezes 4! Body cream sale in the daytime ⇒ Oil massage of meat stick at night ☆ Pleasure service immediately gin erection! Creampie SEX that tightens the vagina from Kyun Ky

  • amateur censoredcreampiesquirtingmlamla-036mla036476mla-036
    • 2021-05-05
    52 min

    FC2PPV 1803283 [2980 → Limited number 1980] Anxious about her husband’s barre and seeing this ❤ Serious beautiful wife working at the station ❤️ Unprocessed pubic hair ❤️ Lie to her husband Sex overtime ❤️ Gachi NTR excitement 2 consecutive vagi

  • amateur uncensoredfc2
    • 2021-05-13
    145 min

    [ABW-092]全裸家政婦 新感覚ヴァーチャルセックス性活をあなたに。 Staff01 愛音まりあ 【MGSだけのおまけ映像付き 10分】

  • amateur censoredamateurabwabw-092abw092abw-092
    • 2021-05-14
    119 min

    [PPPD-931]"Uh, My Boyfriend Is The Worst" I Shared A Table With A Girl After Her Shift, And When I Noticed She Was Coming On To Me... I Took Her Back To A Hotel For Friday-To-Monday Fuckathon With Amazing, Sweaty Sex Mikako Horiuchi

  • mikako horiuchi censoredcreampiebig titsPPPDoppaiPPPD-931PPPD931pppd00931
    • 2021-05-22
    96 min

    FC2PPV 1830409 Celebration! The 4th 1st Anniversary Appreciation Project! 2980PT → 1980PT [Beautiful wife NTR with no individual shooting, outflow, 〇Snow very similar] Called a beautiful mom model with SEX-less and cheating habit at work and conceive

  • amateur uncensoredfc2
    • 2021-06-02
    88 min

    300MAAN-659 [Sweat Duck x Orgy] "Sayaka-san"’s Marunage Request! Soul and soul full sex! Eat steak and keep shaking your hips as long as you keep fit! Massive squirting inevitable lack of water! Enjoy long-time sex in a state of sweat, t

  • amateur censoredcreampiesquirtingmaanmaan-659maan659300maan-659
    • 2021-06-03
    49 min

    FCP-020 [Delivery only] Transparent chair x dildo! !! Super radical masturbation delivery that is too erotic! !!

  • amateur censoredbig titsamateurfcpfcp-020fcp020fcp-020
    • 2021-06-24
    123 min

    [DLDSS-012]Whole Body Experience: Massage Parlor Slut Drains Your Balls Dry Tina Nanami

  • nanami tina censoredsingle workDLDSSdahliaflagmanDLDSS-012DLDSS0121dldss00012
    • 2021-07-02
    144 min

    [JUL-631]A Married Woman Secretary, Engaged In Creampie Sex, Filled With Sweat And Kisses, In The Boss' Office The Ultimate In Bewitching Beauties Will Provide You With The Ultimate In Kissing (Creampie Sex) In This Masterpiece Drama!! Ryo Ayumi

  • ayumi ryo censoredcreampiemature womanJULmadonnanagaeJUL-631JUL631jul00631
    • 2021-07-02
    101 min

    [SHKD-956]Escaped Prisoner - Mahiro Ichiki

  • mahiro ichiki censoredsingle workSHKDattackerskinsharkSHKD-956SHKD956shkd00956
    • 2021-07-02
    170 min

    [DVDMS-683]Ordinary Couple Hidden Camera Footage AV X Magic Mirror Bus Collaboration Project "While In Japan These Cabin Attendants Can't Get Over Wanting To Try Japanese Cock" Is The Rumor True!？ A Chinese Cabin Attendant With Beautiful

  • censoredcreampieamateurDVDMSdeep sking of genkingDVDMS-683DVDMS683dvdms00683
    • 2021-07-03
    140 min

    [PKPD-152]Sugar Baby Creampie Job Search Rui Sucks Cock With Her Plump Lips In Return For Money Rui Komatsu

  • komatsu rui censoredcreampiesingle workPKPDfuck group and fun friends daydreamersPKPD-152PKPD152pkpd00152
    • 2021-07-03
    54 min

    H4610 ki210704 Yuiko Matsui 26years old

  • amateur uncensoredh4610
    • 2021-07-29
    55 min

    FC2PPV 1946160 ☆ First Shot ☆ Complete Appearance ☆ Slender Beautiful Girl With Long Black Hair 20 Years Old ♥ Overflowing Sex Appeal And Immediate Wetness Oma ○ I Was Excited About This And Released A Lot ♪ [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-08-11
    64 min

    500DPL-0031 Active Boutique Clerk 24 Years Old

  • amateur censoredcreampieamateurdpldpl-0031dpl0031500dpl-0031
    • 2021-08-13
    35 min

    FC2PPV 2008456 First Shot! !! Appearance! !! Limited Number! [Uncensored] Overwhelming Beauty And A Lascivious Look … Creampie Twice In A Famous Ecup Beauty Who Is Full Of Charm! !! (Feature Film)

  • amateur uncensoredfc2
    • 2021-08-20
    142 min

    [CAWD-265]A Beautiful Y********l in Uniform Who Wants Some Pocked Money, So She Skipped School To Suck Off Some Disgusting Older Guy - Ren Midorika

  • midoriya ren censoreduniformschoolgirlCAWDkawaiiCAWD-265CAWD265cawd00265
    • 2021-08-21
    60 min

    Pacopacomama 082121_521 Enchanted By The Pleasure Of Anal Mikako Tachibana

  • amateur uncensoredpacopacomama
    • 2021-08-27
    128 min

    [WZEN-048]Banned 01, Pharmaceutical Company Office Worker Mika (27)

  • censoredcreampiedeepthroatWZENwaap entertainmentWZEN-048WZEN0482wzen00048
    • 2021-09-02
    101 min

    [AKDL-136]A S*****t"s Guardian Tells Me "Today Is My Safe Day" And When We Meet I Give Her Creampies Over And Over Tsukasa Nagano

  • tsukasa nagano censoredcreampiemarried womanAKDLaquinoriaquinoriaknrAKDL-136AKDL1361akdl00136
    • 2021-09-03
    69 min

    529STCV-011 Kanon-Chan (18)

  • amateur censoredcreampiebig titsstcvstcv-011stcv011529stcv-011
    • 2021-09-23
    118 min

    [FSDSS-292]Shared Room NTR Carnal Lascivious Female Office Worker Makes Married Boss Fall Completely Ena Satsuki

  • ena satsuki censoredbeautiful girlsingle workFSDSSfalenonikusonfaleno starFSDSS-292FSDSS2921fsdss00292
    • 2021-10-23
    225 min

    [XRLE-020]Throat Fuck Creampie Hottie Training, Inori Sasage

  • dedication glue censoredbeautiful girldeepthroatXRLEk m produceani nakamurareal real worksXRLE-020XRLE020xrle00020
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored