big butt jav javcensored tits delusion group




FC2KSBJMIDVNACXSQTESTARSVEMAMEYDCHRVSSISSPRDLULUJUFEAMBIFSDSSAUKGVENURBDROYDBBANBLK

2021-01-16
61 min

1Pondo 011621_001 Seducing by Flashing Pussy: Nana Kamiyama

  • amateur uncensored1pondo
    • 2021-01-23
    42 min

    [HHKL-081]All Alone With The Hottest Girl At Work During A Downpour... Her Blouse Is Soaked Right Through And I Can See Her Tits... Which Got Me Hard. When She Noticed, She Turned Red - Then Started Hitting On Me？! Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampieuniformHHKLhuntermorikihhh groupHHKL-081HHKL081hhkl00081
    • 2021-02-01
    120 min

    [NACR-394]Unfaithful Housewives: A Son's Wife Seduced By Her Father-In-Law Into Shocking Adultery Natsuki Nagahara

  • nagatsuki natsuki censoredcreampieblowjobNACRplanet plusbito sakurananakuruNACR-394NACR394h-237nacr00394
    • 2021-02-01
    306 min

    [CHA-024]Boobs Everywhere

  • censoredbig titsCHAlahaina tokaichaosCHA-024CHA024h-189cha00024
    • 2021-02-03
    134 min

    [OVG-163]Suddenly Entering A Housewife's Home In The Morning While Her Husband Is Away And Giving Her A Raw Creampie Fuck!

  • kaori iiyama yuka hoshi censoredcreampiebig titsOVGglory questOVG-163OVG16313ovg00163
    • 2021-02-05
    73 min

    374SHOW-043 Asaka

  • amateur censoredmarried womanamateurshowshow-043show043374show-043
    • 2021-02-05
    189 min

    [PLY-002]I'm So Embarrassed! A Reluctant Car Sex Documentary Himari Kinoshita/Nana Yaotome

  • nana yaotome himari kinoshita himari hanazawa censoredPLYplay entertainmentkaji shun wareplayPLY-002PLY002h-1557ply00002
    • 2021-02-05
    243 min

    [MMB-350]Daydream Slut

  • misono waka scolding censoredbig titsbeautiful girlMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-350MMB350mmb00350
    • 2021-02-07
    139 min

    [PKPD-131]Total Persuasion: Shizuku Asahi & Mirai Kogure

  • asahi drop kogure mirai censoredcreampieschoolgirlPKPDfuck group and fun friends daydreamersPKPD-131PKPD131pkpd00131
    • 2021-02-12
    171 min

    [SCPX-419]You Slept With My Wife, So It's Only Fair That I Get To Fuck Yours, Right？ Cucked Husband Demands An Apology In The Flesh While The Other Husband Watches

  • censoredbig titsSCPXscoophasshimousouzokuSCPX-419SCPX419h-565scpx00419
    • 2021-02-19
    125 min

    [KTKC-106]These Are The Famous Streetwalking Reverse Pick Up Colossal Tits Girls In A Town In The Northern Kanto Region, Who Have Recorded 3,000 Mounting, Grinding, Raw Cowgirl Fucks, And We've Captured 12 Fucks In One Day In The Creampie Documen

  • censoredcreampiebig titsKTKCkitixx mousouzokubig titsKTKC-106KTKC106ktkc00106
    • 2021-02-19
    120 min

    [KSBJ-119]A Son's Wife Turned Out To Be A Lewd Woman, Through And Through... Maron Natsuki

  • marin natsuki censoredcreampieblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-119KSBJ119ksbj00119
    • 2021-02-28
    182 min

    [SQIS-044]The Pursuit Of Pleasure Without End: Fucking Married Women!

  • censoredbig titsmature womanSQISfaSQIS-044SQIS044sqis00044
    • 2021-03-01
    66 min

    324SRTD-0217 Picking Up A Dirty Married Woman Who Is Not Satisfied With Child Making SEX

  • amateur censoredcreampiemarried womansrtdsrtd-0217srtd0217324srtd-0217
    • 2021-03-09
    123 min

    [SDNM-271]Girls Who Do Their Best At Work And At Home Are The Horniest - Hikaru Konishi, Age 29 - Final Chapter - Even If She Gets Knocked Up, She Won't Know Who The Father Is - Pumped Full Of Cum By 8 Different Guys - 14 Bukkake And Creampie Loa

  • hikaru konishi censoredcreampiemature womanSDNMsod createakira saijogenuine married woman the porn experienSDNM-271SDNM2711sdnm00271
    • 2021-03-13
    145 min

    [SINN-017]This Married Woman Is Okay With Getting Pregnant! A Video Record Of A Beautiful Mature Woman Who Only Gets Excited Through Creampie Infidelity, Now Refined Into A Perverted Cum Bucket "If Possible, I'd Like To Fuck A Man Who Has The

  • censoredcreampiemature womanSINNshinsekai mousouzokuSINN-017SINN017sinn00017
    • 2021-03-13
    120 min

    [MUDR-141]College Intern Hit On By Her Boss On An Overnight Business Trip - Face-Licking, Dripping With Erotic Fluids, Creampie Cheating Sakura Tsukino

  • tsukino sakura censoredcreampiesingle workMUDRmukuMUDR-141MUDR141mudr00141
    • 2021-03-18

    FC2PPV 1731298 Limited to 21 [Uncensored] JD with one experienced boyfriend, first vaginal cum shot with sex for the first time in a long time

  • amateur uncensoredfc2
    • 2021-03-28
    58 min

    [490FAND2-1]れん 1

  • amateur censoredbig titsamateurfand2fand2-1fand21490fand2-1
    • 2021-04-02
    150 min

    [PRED-300]I Fucked My Son's New Wife Over And Over And Realized A Decade's Old Dream! Ai Hoshina

  • sena ai censoredcreampiesingle workPREDpremiumtrendy yamaguchielegancePRED-300PRED300pred00300
    • 2021-04-02
    245 min

    [HEZ-274]Picking Up Married Sluts For Creampie Orgasms 33 - Shinagawa Edition

  • censoredcreampiebig titsHEZhot entertainmentstudio zeroHEZ-274HEZ27459hez00274
    • 2021-04-10
    61 min

    383REIW-055 Waka

  • amateur censoredbig titsamateurreiwreiw-055reiw055383reiw-055
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-07
    119 min

    [MEYD-676]The Truth Is, My Husband's Boss Is Fucking Me ... Tsubaki Kato

  • kato camellia kaoru natsuki censoredcreampiesingle workMEYDtameike goronaveMEYD-676MEYD676meyd00676
    • 2021-05-07
    152 min

    [DASD-858]I'm A Lowly S*****t, But I Succumbed To The Sweet Temptation Offered By Two Female Teacher Babes, And Now, After School, We're At The Love Hotel, Having Creampie Sex, Over And Over And Over Again. Waka Misono Yuria Yoshine

  • misono waka yoshine yuria censoredcreampiebig titsDASDdasrokusaburo mishimaDASD-858DASD858dasd00858
    • 2021-05-11
    64 min

    Caribbeancom 051121-001 Sex practice with my sister-in-law who wants to work in luxury spa Rino Sakuragi

  • rino sakuragi uncensoredcreampiecaribbeancom
    • 2021-05-14
    119 min

    [PPPD-931]"Uh, My Boyfriend Is The Worst" I Shared A Table With A Girl After Her Shift, And When I Noticed She Was Coming On To Me... I Took Her Back To A Hotel For Friday-To-Monday Fuckathon With Amazing, Sweaty Sex Mikako Horiuchi

  • mikako horiuchi censoredcreampiebig titsPPPDoppaiPPPD-931PPPD931pppd00931
    • 2021-05-14
    73 min

    FC2PPV 1811060 ＃ 61 Miu, a beautiful busty girl in a yukata, screams and cums inside Gokkun [Personal shooting] [Gonzo] [High image quality]

  • amateur uncensoredfc2
    • 2021-05-14
    93 min

    380SQB-101 Luna

  • amateur censoredamateurbeautiful girlsqbsqb-101sqb101380sqb-101
    • 2021-05-15
    59 min

    C0930 ki210516 Ranko Yokofusa 24years old

  • amateur uncensoredc0930
    • 2021-05-20
    122 min

    [IENF-142]Amateur Pick Up Naive College Girl Has Her First Experience At A Brothel For Ladies 2

  • aina hayashi rina takase censoredcreampieamateurIENFienergytiger kosakaiienfIENF-142IENF1421ienf00142
    • 2021-05-21
    119 min

    [JUL-578]Madonna "Dengeki Transfer" Part 2!! After My Husband Tries To Get Me Pregnant, My Father-in-law Always Follows Up By Filling My Pussy With His Own Cum... Kana Yume

  • kana yui censoredcreampiemature womanJULmadonnajotaro tomiJUL-578JUL578jul00578
    • 2021-05-28
    136 min

    [MIDE-933]My Big Tits Girlfriend And I Confined Ourselves To A 2-Day, 1-Night Hot Spring Resort Vacation Where All We Did Was Fuck Our Brains Out Fumika Nakayama

  • nakayama fumika censoredbig titssingle workMIDEmoodyzmametaro mamezawamoodyz divaMIDE-933MIDE933mide00933
    • 2021-05-29
    61 min

    Caribbeancom 052921-001 Luxury Adult Healing Spa: Maki Koizumi

  • maki koizumi uncensoredcreampiehandjobcaribbeancom
    • 2021-06-01
    120 min

    [NACR-430]Seduced By My Son's Sexually Frustrated Wife Maya Hongo

  • hongo maya censoredcreampieblowjobNACRplanet plusbito sakurananakuruNACR-430NACR430h-237nacr00430
    • 2021-06-04
    76 min

    230OREC-776 Miyu-san

  • amateur censoredmarried womanamateurorecorec-776orec776230orec-776
    • 2021-06-06
    46 min

    188HINT-0463 Misa

  • amateur censoredcreampiemarried womanhinthint-0463hint0463188hint-0463
    • 2021-06-08
    123 min

    [STARS-390]She Swallows Your Whole Cock Until You Cum - Long-Licking Blowjob. Hibiki Natsume (Bust Your Nut In Incredible 4K Resolution!)

  • natsume hibiki censoredblowjobbeautiful girlSTARSsod createsuisei akaisod starSTARS-390STARS3901stars00390
    • 2021-06-19
    40 min

    519MAZOF-003 [Excitement] WEB media management site President ♀ 38 years old An estrus female who panting on a man’s penis at night, even though he is a man with a mission of "women’s success". I’m pleased to be hit in the ass

  • amateur censoredcreampieamateurmazofmazof-003mazof003519mazof-003
    • 2021-06-24
    210 min

    [SW-782]My Female Colleagues Seduce Me By Showing Off Their Panties Through Their Black Pantyhose In The Office And On Business Trips - Do You Mind If I Rip Your Stockings And Stick My Dick In？

  • censoredSWswitchyocchanswitch hibinoSW-782SW7821sw00782
    • 2021-06-25
    66 min

    SIRO-4558 [First shot] [Innocent] [Super beautiful legs x small nice ass] A slender beautiful girl who sticks out her small nice ass to the camera and fascinates her desperate look. Serious sex of active college students is the main story! AV applica

  • amateur censoredamateursirosiro-4558siro4558siro-4558
    • 2021-07-02
    152 min

    [JUL-646]

  • osamu osamu censoredcreampiemature womanJULmadonnabieber gonzoJUL-646JUL646jul00646
    • 2021-07-03
    130 min

    [PKPD-153]Time Limited Porn Star One Month Of Creampies With Miss Rika, An English Teacher With Unbelievably Gorgeous Legs

  • censoredcreampiePKPDfuck group and fun friends daydreamersPKPD-153PKPD153pkpd00153
    • 2021-07-17
    151 min

    [HMN-020]Passionate, Wet Kissing And Creampie, Staring Mitsuki Hirose

  • mitsuki hirose censoredcreampiebeautiful girlHMNhon nakausa pyonHMN-020HMN020hmn00020
    • 2021-07-24
    37 min

    [PSST-028]Young Married Beauty Makes Her Porn Debut! Beautiful European Woman's First Time Having Sex On Camera! Cindy

  • censoredmarried womanamateurPSSTpatzkin amateurbooker tPSST-028PSST028h-1450psst00028
    • 2021-07-30
    116 min

    [ATID-473]The Beautiful Mature Woman Who Became Prisoner Of The Black Serpent Tsubaki Kato

  • kato camellia kaoru natsuki censoredmature womansingle workATIDattackershaga eitarouin madATID-473ATID473atid00473
    • 2021-07-31
    50 min

    C0930 gol0167 Sumiko Terai 29years old

  • amateur uncensoredc0930
    • 2021-07-31
    240 min

    [MMB-380]Nipples Say A Thousand Words No Matter How She Tries To Hide It, Her Rock-Hard Nipples Reveal That She"s Just Begging To Get Fucked Video Of Women Convulsing As They"re Fucked Hard And Fast

  • arimura nozomi shirosuku kurosaki censoredMMBmomotaro video publishingdr ishikiri bridgemomotaro bestMMB-380MMB380mmb00380
    • 2021-08-07
    187 min

    [BANS-004]Nihao Saiko 4

  • miyazaki rin eimi kurusu censoredcreampieblowjobBANSniihao saikou mousouzokuBANS-004BANS004bans00004
    • 2021-08-13
    208 min

    [HUNTB-080]She Was Bored With Normal Sex, And Wanted More Excitement, So She Decided To Take The Plunge Into Lesbian Love! But She Was Embarrassed, And Wasn"t Able To Take That Leap. So We Made A Suggestion, "It Won"t Be So Bad If A Cock

  • censoredcreampielesbianHUNTBhunterkonnyaku kannohhh groupHUNTB-080HUNTB080huntb00080
    • 2021-08-14
    241 min

    [AQMB-026]Mommy"s Tennis Club, Wife"s Creampie Lesson At Hom After Practice, 4 Women

  • shinoda yu kana morisawa kanako iioka censoredcreampiemature womanAQMBaqua mall heroaqua mallAQMB-026AQMB026aqmb00026
    • 2021-08-21
    138 min

    [CEAD-357]Glasses Sex 3! Wan Horikita SEX Wearing Black Rimmed Glasses: Uniform, Glasses SEX: Recruit Suits & Glasses SEX And...

  • horikita wan censoredmature womansingle workCEADserebu no tomoCEAD-357CEAD357cead00357
    • 2021-08-23
    106 min

    FC2PPV 2066648 First Shot ♥ ️ Complete Appearance ♥ ️ 164/46 Fair-Skinned Slender Beautiful Girl ♥ ️ Teenage Active Girl With Zero Male Experience Though Cute Like An Idol ○ Student Challenges Loss Of Virginity ♥ ️ The Moment When A Meat Stick Digs I

  • amateur uncensoredfc2
    • 2021-08-27
    109 min

    [MDVHJ-037]The Indecent Sex Life Of An Older Man And A Widow Chapter 2 - Ayaka Muto

  • ayaka muto censoredbig titsmature womanMDVHJgurafiteijapanmovieMDVHJ-037MDVHJ03748mdvhj00037
    • 2021-09-18
    120 min

    [AQSH-076]Part-time Call Girl Gets Exposed By Male Clients That Were Bullied. Female CEO Gets Used For Sex By Her Subordinates After They Were Teased. Miki Matsuzaka

  • miki matsuzaka censoredcreampiemature womanAQSHaqua mall heroaqua mallAQSH-076AQSH076aqsh00076
    • 2021-09-24
    149 min

    [AKID-087]Horny Insta-Fuck Girls Only We Took The Home For A Peeping Good Time And Then We Sold The Footage Without Permission As An Adult Video No.46 Emi / G-Cup Titties / 26 Years Old / Height: 165cm Nanae / D-Cup Titties / 23 Years Old / Height: 1

  • censoredcreampieblowjobAKIDomochikaeri mousozokumanji groupAKID-087AKID087akid00087



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored