big tits censored def creampie jav




FC2SPRDDASDAUKSAPODAMBIDTTAVSASSISHNDMIAASQTEMEYDFSDSSGMEMVENUBBANAUKGCJODCAWDSDAB

2021-01-01
110 min

[ANB-183]Beautiful and Erotic Aunt's Perversions Are Running Wild And Overwhelming Me - Yoko Ikeda

  • yoko ikeda censoredmature womanslutANBrubysusumu yanokuchinobleANB-183ANB183anb00183
    • 2021-01-17
    117 min

    [DDFF-006]超高級M女専門サロン 即尺＆輪●VIPコースで生ハメエンドレス5P調教 弥生みづき

  • mizuki yayoi censoredcreampiesquirtingDDFFdogmafk2DDFF-006DDFF006ddff00006
    • 2021-01-17
    240 min

    [SORA-292]Overnight Blowjob Date With My Cum Swallowing Fuckbuddy Aya Mamiya

  • aya mamiya censoredSORAmountain and sky delusion groupelectric trainmountains and skySORA-292SORA292sora00292
    • 2021-02-06
    144 min

    [BBAN-311]Business Massage Parlor. Young Wife Seduced Into Lesbian Sex By Nimble Hands - Horny Married Slut Falls For Her Masseuse On A Business Trip. Hazuki Wakamiya Mao Kurata

  • wakamiya kurata mao censoredbig titslesbianBBANbibianBBAN-311BBAN311bban00311
    • 2021-02-12
    151 min

    [EBOD-803]119 Climaxes! 104 Spasms Of Ecstasy! 2300 mL Of Squirting! Slim, Beautiful Babe With Big Tits Who Works As A Nurse And Social Media Influencer Takes Her First Creampie & Raw Fuck - On Camera! Mikako Horiuchi

  • mikako horiuchi censoredcreampiebig titsEBODe bodymon cEBOD-803EBOD803ebod00803
    • 2021-02-19
    230 min

    [ABW-058]1 Vs 1 (*No Acting, No Faking) 4 One-On-One Basic Instinct-Baring Fucks ACT.19 Absolutely No Scripts, Just 1-On-1 No-Holds-Barred Sex ... Matsuoka Is Ready To Show How Serious She Is, And Show Everything She's Got. Suzu Matsuoka

  • matsuoka tin censoredblowjobdeepthroatABWprestigenoresore kawasakiabsolutely wonderfulABW-058ABW058118abw00058
    • 2021-02-25
    120 min

    [FSDSS-177]If You Get Caught, You're Out! We Pretended To Be A Couple And Entered This Establishment, Undercover! Dripping With Adrenaline The Ultimate Real And Silent Sex At A Business Establishment, While They're Still Open For Business Tin

  • nanami tina censoredsingle workFSDSSfalenoponyfaleno starFSDSS-177FSDSS1771fsdss00177
    • 2021-02-26
    28 min

    359TYVM-134 Mizuho

  • amateur censoredbig titsamateurtyvmtyvm-134tyvm134tyvm-134
    • 2021-02-27
    51 min

    C0930 ki210228 Mariko Miyazawa 24years old

  • amateur uncensoredc0930
    • 2021-03-05
    122 min

    [UMD-769]I Was In The Hospital For So Long That I Got A Hard On Even For This Old Lady Nurse's See-Through Pants 2

  • kimishima mio aishin shinkawa censoredsluthandjobUMDleodragon nishikawaUMD-769UMD769125umd00769
    • 2021-03-11
    65 min

    336KNB-145 "My father is a fraud …" I can cry because the reason for applying is annoying! The body that I have never forgiven other than my husband since I got married is revealed! Raise a sweet pant voice in front of a tech that you ha

  • amateur censoredbig titsmarried womanknbknb-145knb145336knb-145
    • 2021-03-12
    69 min

    [orec-720]りかちゃん

  • amateur censoredcreampiebig titsorecorec-720orec720orec-720
    • 2021-03-14
    61 min

    413INST-104 Extra-fine slender loli girl, almost "virgin" Futaba-chan 18 years old ♪ Delicate and crunchy body that stopped growing at 6th grade Demon piston ☆ Thick dick tightened tightly Ribs stand out and warp acme! Gonzo SEX that falls in

  • amateur censoredamateurbeautiful girlinstinst-104inst104413inst-104
    • 2021-03-22
    61 min

    326EVA-161 [Creampie 3 barrage] No. 1 in the girl’s bar beauty Momojiri ranking! !! Meat stick sucking with tongue blowjob! Nipple Iki & Beautiful Big Breasts E Cup Bombing Cowgirl Cums With All One Heart! Super sensitive shaved pussy convuls

  • amateur censoredcreampieamateurevaeva-161eva161326eva-161
    • 2021-03-25
    125 min

    [JRZE-037]First Time Filming My Affair - Nanako Agawa

  • nanako agawa censoredcreampiemature womanJRZEcenter villagejiro fukagawajurakuJRZE-037JRZE037h-086jrze00037
    • 2021-03-29
    46 min

    FC2PPV 1746662 [First shot / Non-stop creampie cum swallow] Blue ● young lady is cum swallowing in 39 minutes 4 cum swallowing circle 12 Leona

  • amateur uncensoredfc2
    • 2021-04-01
    63 min

    SIRO-4459 [First shot] [Fluffy natural boobs] [Sorry for all the fans] G milk beauty who sprinkles another dimension of beauty participates in the war! A gravure idol whose first experience in life is shot with a camera .. AV application on the net →

  • amateur censoredamateursirosiro-4459siro4459siro-4459
    • 2021-04-02
    174 min

    [SSIS-036]Exclusive NO.1 STYLE The Gravure Idol Kaoru Yasui Her S1 Debut

  • kaoru yasui censoredbig titssingle workSSISs1 no 1 stylemon cSSIS-036SSIS036ssis00036
    • 2021-04-09
    148 min

    [EBOD-815]120 Service: Whether It's Sex Or Her Work, This Curvy I-Cup Gives It Her Best - Busty Clerk At A Burger Shop Riku Serina

  • serina riku censoredbig titssquirtingEBODe bodymichiru arashiyamaEBOD-815EBOD815ebod00815
    • 2021-04-18
    101 min

    [GNAX-051]Prim, Pretty Female Doctor Ravished By Homeless Guys Ririi Hosho

  • hosei lily censoredbig titssingle workGNAXnagiranagira kenzonagira nagiraGNAX-051GNAX051gnax00051
    • 2021-04-22
    123 min

    [FSDSS-208]Unlimited Number Of Ejaculations! Girl Who Loves Older Men Will Let You Cum As Many Times As You Want Sora Shiina

  • shiina sky censoredcreampiesingle workFSDSSfalenowild sevenfaleno starFSDSS-208FSDSS2081fsdss00208
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-08
    122 min

    [XRL-005]Disciplining A Beautiful Young Wife With Debt Problems With Dirty Talk Himari Kinoshita

  • himari kinoshita himari hanazawa censoredblowjobsingle workXRLreal worksreal real worksXRL-005XRL005xrl00005
    • 2021-05-13
    110 min

    [MHAR-001](The Men's Massage Parlor Everybody's Talking About) Mature Woman Masseuse's Secret Raw Creampie SEX Options 1

  • censoredcreampieamateurMHARmilf laboMHAR-001MHAR001h-1160mhar00001
    • 2021-05-16
    67 min

    200GANA-2492 Seriously Nampa, first shot. 1637 De M beauty who is enjoying being erotic with daddy activity! Bring it to the studio and strangle Irama and fall into pleasure with a piston! The voluminous feeling of the plump body and swaying milk com

  • amateur censoredbig titsamateurganagana-2492gana2492200gana-2492
    • 2021-05-25
    70 min

    Caribbeancom 052521-001 Sex Orgy : 2 Horny Girls Compete Against Each Other For Hard and Big Dick! Eri Hoshikawa, Maki Kawano

  • eri hoshikawa uncensoredcreampielesbiancaribbeancom
    • 2021-05-28
    198 min

    [WAAA-061]If You Can Withstand Honoka Mihara's Incredible Techniques You Can Fuck Her Raw!

  • mihara honoka censoredcreampiebig titsWAAAwanz factorywanzWAAA-061WAAA061waaa00061
    • 2021-06-14
    57 min

    [NYH-127]The Story Of How I Fucked My First Love At Our Class Reunion Miss Azusa Azusa Misaki

  • misaki azusa censoredbig titsmarried womanNYHdirectorsdirectorsnyan nyan houseNYH-127NYH1271nyh00127
    • 2021-06-15
    120 min

    [ZEX-405]Hot And Steamy Sex Pure And Innocent Sex Pure Lesbians In A World With Only Beautiful Women OR Dark Crazy Instinctual Sex

  • yuri sugawa satomi yuria censoredbig titslesbianZEXpeters maxZEX-405ZEX405h-720zex00405
    • 2021-06-15
    116 min

    [KIRE-041]Celebrity Yume Nanase AV DEBUT

  • nanase yume censoredsingle workKIREsod createnao masakibeauty kirei sodKIRE-041KIRE0411kire00041
    • 2021-06-18
    36 min

    FC2PPV 1874485 Limited number [Uncensored] Road to a longing voice actor … Reality a few months after that … Creampie in big breasts of anime voice! !!

  • amateur uncensoredfc2
    • 2021-06-24
    73 min

    200GANA-2515 Seriously Nampa, first shot. 1652 Bring the gal JD on the way back from the hairdressing shop to the hotel as an interview! Pretending to be drunk and trying to do something sexually harassing …？ The fair-skinned body and smooth but

  • amateur censoredsquirtingamateurganagana-2515gana2515200gana-2515
    • 2021-07-01
    242 min

    [NACX-082]Big-Titted Mature Women's Creampies: 20 People, The BEST

  • shiho terashima erica kitagawa censoredcreampiebig titsNACXplanet plusnanakuruNACX-082NACX082h-237nacx00082
    • 2021-07-03
    88 min

    DCH-004 Mai

  • amateur censoredcreampiebig titsdchdch-004dch004dch-004
    • 2021-07-06
    82 min

    493NAEN-078 Yen! ？？ Systemic genitals! ？？ Super Sensitive Bitch Girls ○ Ryoka Kurumi Commits Raw High Speed Piston All Night

  • amateur censoredamateurbeautiful girlnaennaen-078naen078493naen-078
    • 2021-07-14
    108 min

    [SPRD-1440]There's Nothing Like My Older Ex-Wife, Starring Rina Takakura

  • takakura rina censoredmarried womansoloworkSPRDtakara eizokyuta tukumoaleddinSPRD-1440SPRD1440
    • 2021-07-23
    160 min

    [LULU-087]My Colleague At My Part-Time Job Is A Big Tits Single Mother Who Let Me Stay At Her Place After I Missed The Last Train Home, And We Were Hanging Out, But She Was Unable To Hide How Horny She Was, So We Had Creampie Sex Until The Break Of D

  • ayaka muto censoredcreampiebig titsLULUlunaticsluminaxLULU-087LULU087lulu00087
    • 2021-08-14
    124 min

    [DBER-120]Devilish Hot Meat Shaking Penetration Machine Part 3, Crazed Climax Heaven

  • inaba natsuho imai censoredDBERbaby entertainmentred babeDBER-120DBER120dber00120
    • 2021-08-20
    93 min

    277DCV-188 Is It Okay To Send It Home？ Case.182 Pillage! Ntr! The Villainous Fucking Bitch Who Always Drops The Target Man! [Magic Belochu Barrage Sp] ⇒ Vaginal Kiss In French Literature! Erotic Deviation Value Exceeds 70 ⇒ 300 People Slash On The Sa

  • amateur censoredamateurdcvdcv-188dcv188277dcv-188
    • 2021-08-21
    77 min

    200GANA-2541 Seriously Nampa, First Shot. 1679 Picking Up A Show Bread Gal That You Will Fall In Love With Long And Plump Legs! When You Beloch, There Is A Nasty Thread On The Sexy T-Back …

  • amateur censoredsquirtingamateurganagana-2541gana2541200gana-2541
    • 2021-08-27
    80 min

    529STCV-007 Mizuki (Minami Mizuki)

  • amateur censoredcreampieschoolgirlstcvstcv-007stcv007529stcv-007
    • 2021-09-09
    123 min

    [FSDSS-285]Massage Parlor For Men That Keeps Sucking After Enjaculation. Hiyori Yoshioka

  • hiyori yoshioka censoredbeautiful girlsingle workFSDSSfalenogoemonfaleno starFSDSS-285FSDSS2851fsdss00285
    • 2021-09-09
    125 min

    [NEO-764]I Want To Lick The Face Of A Barely Legal While She Is Peeing In Her Pants, Karen Kyowa

  • karen anba censoredsingle workNEOradixsakuraba kyuu kokoro otokoneo radixNEO-764NEO764433neo00764
    • 2021-09-17
    118 min

    [MIDE-973]Reversal! Fumika The Investigator Who Keeps Getting Fucked By Bad Guys Fumika Nakayama

  • nakayama fumika censoredbig titssquirtingMIDEmoodyzkyouseimoodyz divaMIDE-973MIDE973mide00973
    • 2021-09-24
    139 min

    [ROYD-069]Luna The Bitch Nurse Who Eats Out The Patients When She Finds That They Are Virgins Luna Tsukino

  • tsukino luna censoredsingle worknurseROYDroyalaldebaranhhh groupROYD-069ROYD069royd00069
    • 2021-09-25
    156 min

    [MADV-512]C***dhood Friend That"s Completely Sex Crazed From Breaking In Is Given Over To A Serious Friend. Aoi Kururugi

  • aoi kururugi censoredcreampiebeautiful girlMADVcrystal eizoupearlrice sakagamimaniac crystalMADV-512MADV512madv00512
    • 2021-09-30
    64 min

    336KNB-174 The Thirty Wife Who Decided To Appear In The AV Saying "I’m Not With My Husband And I Haven’t Met In Corona …". A Slightly Healing Marshmallow Body Married Woman Is Disturbed By Another Stick! !! !! !! I Will Take A

  • amateur censoredmarried womanamateurknbknb-174knb174336knb-174
    • 2021-10-01
    160 min

    [DVDMS-723]General Male/Female Monitoring AV Special Tracking Down Club Members Who Had Continous Sex In Men"s Bath During Training Camp. Everyone"s Favourite Female Manager Gives The Virgin Boy Special Attention When He Can"t Get An Erec

  • censoredcreampiebig titsDVDMSdeepspoolsideDVDMS-723DVDMS723dvdms00723
    • 2021-10-09
    126 min

    [NSFS-032]A Marital Hostage Incident. A Wife Is Used As A Fuck Toy From Morning To Night. Haruka Nogi

  • haruka nogi censoredmature womansingle workNSFSnagae styletomitake taroNSFS-032NSFS032nsfs00032
    • 2021-10-11
    115 min

    300MIUM-754 Fluffy Big Breasts Advent! !! A Trip To The Miura Peninsula With An H-Cup Beauty That You Can’t Take Your Eyes Off From The Moment You Meet! If You Rush Into Sex While Feeling The Natural Moteora In A Smiling Bright Atmosphere, It Wi

  • amateur censoredcreampiebig titsmiummium-754mium754300mium-754
    • 2021-10-12
    132 min

    [KTRA-337]Extracurricular Creampie Lesson Of A Beautiful Girl With Small Tits Risa Shiroki

  • risa shiroki censoredcreampieKTRAk tribeKTRA-337KTRA337
    • 2021-10-16
    124 min

    [ZOCM-008]We"ll Deliver A Married Woman Slut To Your Door. Ai-san 29 Years Old Ai Kawana

  • ai kawana censoredcreampieslutZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-008ZOCM008zocm00008
    • 2021-10-24
    38 min

    553APLT-004 Bookmark (Shiori Mochida)

  • amateur censoredbig titsuniformapltaplt-004aplt004553aplt-004
    • 2022-01-01
    76 min

    535LOG-006 [Personal Shooting] A Girl Who Is Simple And Wants To Protect. Kamakura Date With Her Proud Girlfriend Machi-Chan! An Enviable Love-Love Couple Walking Next To My Boyfriend With A Smile And Happiness All The Time! As Soon As They Entered T

  • amateur censoredamateurloglog-006log006535log-006
    • 2022-01-08
    163 min

    [SABA-743]Sharing A Hotel Room With My Coworker After We Went Out And Missed The Last Train... She Seemed So Unguarded, I Couldn"t Resist Her... vol. 015

  • censoredcreampieuniformSABAskyu shirototodoSABA-743SABA743saba00743
    • 2022-01-10
    90 min

    300MIUM-786 Go On A Pheromone Ol And A Sabotage Trip With A Godly Balance Of Flesh And Constriction! I Thought He Was A Solid Common Sense Person … It’s A Super Carnivorous System ● This Is Hot And Ready At Any Time Www I’m Completely

  • amateur censoredcreampiebig titsmiummium-786mium786300mium-786



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored