big tits creampie high vision javcensored hours more




FC2ATIDMIDESANLULUBBANRBDAMBIHZGDMIDVVEMAPPPDDTTWAAAHNDDASDMEYDAUKGJULAVSAGVH

2020-11-04
134 min

[GVH-142]Pussy Device BondageXVII: Steel Ties, Pussy Bondage - Natsuho Imai

  • natsuho imai censoreddeepthroatsingle workGVHglory questGVH-142GVH14213gvh00142
    • 2020-11-09
    25 min

    FC2PPV 1563955 [Personal shooting] A young wife who loves other sticks despite being a married woman.

  • amateur uncensoredfc2
    • 2020-11-13
    58 min

    FC2PPV 1568767 Complete appearance ❤️❤️ Rich cum shot SEX while flirting with an idol class beautiful girl (18) ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2020-11-19
    52 min

    FC2PPV 1575784 Super rare [former gravure! ] Explosion J Cup Married Woman 27 Years Old Celebrity Wife Seeded And Cuckold! With a tan oil massage experience, catch and call with the latest swimsuit model for Madam and double the sensitivity with beak

  • amateur uncensoredfc2
    • 2020-11-20
    28 min

    [BTH-088]I Want You To Kiss Me While Putting It In - Yura Kokona

  • yoko kokoro censoredBTHchobitchchovicBTH-088BTH088h-1435bth00088
    • 2020-12-02
    131 min

    [ARM-928]Girls Cum By Rubbing Their Pussies On Men's Body Parts

  • nanako miyamura sakura miyuki censoredARMaroma planninghamu oujiaromaARM-928ARM928arm00928
    • 2020-12-05
    163 min

    [DVDMS-604]A Normal Boys And Girls Focus Group Adult Video This Business Man And Woman Had Sex On The Magic Mirror Number Bus, And We Followed Up On Them To See What Happened In This Special A Married Woman Office Lady And Her Male Colleague Are Out

  • censoredcreampieamateurDVDMSdeep sgreenhouse effectDVDMS-604DVDMS604dvdms00604
    • 2020-12-15
    181 min

    [SDMM-080]The Tables Are Being Turned In This Mid-Summer Edition Of The Magic Mirror Number Bus "Would You Like To See These Amateur Girls At The Beach In Their Bikinis Have Sex In The Raw？" A Seduction Special Featuring Beautiful Girls With

  • censoredbig titsSDMMsod createakira saijomagic mirrorSDMM-080SDMM0801sdmm00080
    • 2020-12-16
    45 min

    FC2PPV 1608572 [Personal shooting / set sale] 29-year-old married woman who has fallen into customs ① ・ ②

  • amateur uncensoredfc2
    • 2020-12-25
    479 min

    [MBM-255]"That's Not Why I Came Here" At Least, That's What She Said, But... He Had A Macho Physique, Unlike Her Older Husband, And He Took Her Home For A Creampie Wife Swap 36 Super Select Beautiful Married Woman Babes 8-Hour Special

  • censoredcreampiemature womanMBMprestigembmMBM-255MBM255118mbm00255
    • 2021-01-13
    50 min

    302GERK-337 E-san

  • amateur censoredcreampiebig titsgerkgerk-337gerk337gerk-337
    • 2021-01-22
    34 min

    FC2PPV 1655375 [Sale for a limited time] Creampie in this wonderful world! Active 19-year-old JD layer Megu ○ n vaginal back mass cum shot 2 shots!

  • amateur uncensoredfc2
    • 2021-01-26
    46 min

    326HGP-002 [Back customs] Hakata’s customs lady Revechi too ww A married woman with a glossy beauty exposes her beautiful hips with transcendent erotic clothes … Creampie night with a dark sex part-time job secret to her husband! !!

  • amateur censoredcreampiebig titshgphgp-002hgp002326hgp-002
    • 2021-01-29
    45 min

    FC2PPV 1664334 [Personal shooting, with W benefits] Nice ass wife finally contacted, and the sobbing of pleasure that continues to leak into the body that can continue to blame …

  • amateur uncensoredfc2
    • 2021-02-01
    92 min

    [MBRAA-191]矢野ひなみ 美少女のおぱんつ

  • yano hina censoredsoloworkMBRAAspice visualMBRAA-191MBRAA191
    • 2021-02-06
    180 min

    [HUNTA-939]They'll Fuck Anyone For A Fixed Fee! If You Pay A Monthly Subion, You Can Fuck Any Of The Female Stuff At This Hospital! Creampie Sex Included! Why Not Try Becoming A Patient...

  • censoredcreampieblowjobHUNTAhunterkorosukehhh groupHUNTA-939HUNTA939hunta00939
    • 2021-02-26
    141 min

    [SQTE-360]Creampie Sex With Nene And Her Godly Breasts - Nene Tanaka

  • nene tanaka censoredcreampiebig titsSQTEs cuteSQTE-360SQTE360sqte00360
    • 2021-02-27
    163 min

    [MIFD-148]A Fresh Face Adult Video Debut This Real-Life College Girl Placed First Place In The The Swimsuits Contest Category Of The Miss Campus Beauty Pageant She Became An Adult Video Actress Instead Of A Female Anchor, And For That, We Say, Thank

  • karen asahina censoredbeautiful girlsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-148MIFD148mifd00148
    • 2021-04-02
    104 min

    277DCV-179 Is it okay to send it home？ case.173 [Is it okay to take a picture of such a person？ SP] Mana Ashida-like peeing anywhere, and when it’s banned, you’ll want to do it [Hentai Caligula Woman] is here! ⇒ Crime thread! Many episodes

  • amateur censoredsquirtingamateurdcvdcv-179dcv179277dcv-179
    • 2021-04-15
    117 min

    [DDHH-027]The Sacrifice Of A Barely Legal Girl - Riko Shinohara

  • riko shinohara censoredschoolgirldeepthroatDDHHdogmahidekiDDHH-027DDHH027ddhh00027
    • 2021-04-22
    63 min

    SIRO-4499 [First shot] [Ubu daughter of withdrawal thought] [Erotic voice leaking] A serious girl who applied to change her inexperienced self. If you teach a naive body pleasure, make a cute voice .. AV application on the net → AV experience shootin

  • amateur censoredamateursirosiro-4499siro4499siro-4499
    • 2021-04-23
    77 min

    FC2PPV 1782713 4 barrages to pull out until it becomes empty with the boobs of a corset slut who emphasizes big tits !! Amateur individual shooting 071

  • amateur uncensoredfc2
    • 2021-05-14
    148 min

    [SSIS-068]Snug And Tight Against Her Tits And Crotch This Elder Sister Type Is Wearing A Knit One-Piece Dress That Hugs Her Curves As She Bats Her Moist Eyes At You, Luring You To Temptation Mei Washio

  • mei washio censoredbig titssingle workSSISs1 no 1 stylekitorune kawaguchiSSIS-068SSIS068ssis00068
    • 2021-06-05
    59 min

    H0930 ori1603 Takae Sasamoto 33years old

  • amateur uncensoredh0930
    • 2021-06-16
    166 min

    [PPPD-936]Dream Resort! Men's Massage Parlor Where Big Titties Are Pressed Up Against You While You're Made To Cum Over And Over! Karen Yuzuriha

  • karen kaede censoredcreampiebig titsPPPDoppaiPPPD-936PPPD936pppd00936
    • 2021-06-18
    69 min

    328HMDN-373 [Millionaire’s Play] Nasty Celebrity Wife 25 Years Old A Beautiful Pussy With 5 Saffles. She is an acme with a nipple licking stakeout piston. Mating that squeezes all sperm from a 20-year-old man

  • amateur censoredcreampiemarried womanhmdnhmdn-373hmdn373328hmdn-373
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-19
    115 min

    [CAWD-235]While My Girlfriend Was Away On A Training Seminar, I Spent The Next 3 Days With My First Love, An Ex-Girlfriend Whom I Could Never Forget, And We Fucked Like Crazy Yuika Aoi

  • yuka aoi censoredsingle workdramaCAWDkawaiitake dCAWD-235CAWD235cawd00235
    • 2021-07-14
    228 min

    [HUNTB-058]"Are You Sure You Want To Sleep With Me？ Our Relationship Will Never Be The Same..." I'm In Love With My Stepsister... And When I Couldn't Take It Anymore, She Accepted My Love...

  • censoredcreampieblowjobHUNTBhuntervolvo nakanohhh groupHUNTB-058HUNTB058huntb00058
    • 2021-07-17
    168 min

    [CJOD-306]"Wanna Come To My Room？" My Neighbors Are Stacked Wives Who Wear Skintight Dresses, Starring Hikari Kisaki And Kyoko Maki

  • hikari hime maki kyoko censoredcreampiebig titsCJODchijo heavenmametaro mamezawaCJOD-306CJOD306cjod00306
    • 2021-07-17
    119 min

    [JUL-657]The Conversion of a Married Woman. Momoko Isshiki.

  • momoko isshiki censoredmature womansingle workJULmadonnajyoji kawaiJUL-657JUL657jul00657
    • 2021-07-18
    139 min

    [SABA-714]See The Vivid Panty Stains On These Beautiful Girl Babes! Squishy, Squashy Finger-Banging Masturbation!! "Ahhh ... I Want You To See Me Cum, Lots And Lots Of Times ..." A Selfie Masturbation Video Letter To You, Because She Loves Yo

  • censoredamateurbeautiful girlSABAskyu shirotoSABA-714SABA714saba00714
    • 2021-08-12
    119 min

    [FTDSS-002]"It"s Nonstop!" Huge And Exciting Orgasms! A Delicate And Lavish Body With A Beautiful White Slender Figure Gets A Huge Cock To Fuck Her Nonstop In Uncut Sex! Yoko Tsukasa

  • yoko tsukasa censoredFTDSSfalenomuranishi tall sizefalenotubeFTDSS-002FTDSS0021ftdss00002
    • 2021-08-20
    152 min

    [CAWD-261]"Hey, Who Do You Like？" 31 Days Of Immersive And Intense Creampie Fucking With Two Younger Step-Sisters Fighting Over Me... Yui Amane Mitsuki Nagisa

  • amane yui scooping censoredcreampiesquirtingCAWDkawaiiakai suiseiCAWD-261CAWD261cawd00261
    • 2021-08-23
    66 min

    498DDH-029 100 Repeat Rate! Excessive Service Of Sexy Veteran Beauticians! Oil Slimy Nipple Torture X Crawl On All Fours → 60 Minutes Full Course That Keeps Ejaculating With Continuous Vaginal Detox!

  • amateur censoredcreampiebig titsddhddh-029ddh029498ddh-029
    • 2021-08-26
    100 min

    435MFC-136 [Taiwan Half Reader Model And Icharab Sex] Secretly Stealth Dinner Date In The Office! I Can Not Suppress My Libido And I Am A Bold Blowjob In The Car! Dense Heat Up At The Hotel 2 Creampie Sex! [Shiroto Gonzo #Meruru ＃ 21 Years Old #Blow

  • amateur censoredcreampieamateurmfcmfc-136mfc136435mfc-136
    • 2021-08-27
    70 min

    529STCV-005 Miku

  • amateur censoredcreampieschoolgirlstcvstcv-005stcv005529stcv-005
    • 2021-08-28
    44 min

    [PSST-031]Two Holes At Once! Blond Married Woman Gets Filled Up For Double Dick Penetration - Pussy And Anal! Winny

  • censoredmarried womanamateurPSSTpatzkin amateurbooker tPSST-031PSST031h-1450psst00031
    • 2021-08-28
    50 min

    [fc2-ppv 2098652]※もし元ハ●プロ系グループのメンバーが連続フェラ抜きごっくん５連発でデビューしたなら FC2-PPV-2098652

  • amateur uncensoredfc2
    • 2021-09-02
    49 min

    C0930 ki210902 Taeko Kashitani 28years old

  • amateur uncensoredc0930
    • 2021-09-04
    122 min

    [MRSS-119]I Recently Discovered That My Beloved Wife Used To Hunt For Sugar Daddies During Her S*****t Days, And That Her Stepfather Had Been Breaking In Her Pussy, Which Means That She Is A Used Cum Bucket. Hikari Sena

  • hikari sena censoredcreampiebig titsMRSSmisesu no sugao emanuelyumesaki ichiroumisesu no sugaoMRSS-119MRSS119mrss00119
    • 2021-09-10
    118 min

    [IPX-729]To Whom It May Concern: "I Slept With My Brother"s Wife." My Sister-In-Law Is A Secret Dick-Sucking Slut. She Lives Out In The Country By The Sea. While My Brother Was Away, I Banged Her. Nanami Misaki

  • nanami misaki censoredblowjobsingle workIPXidea pocketzampadishIPX-729IPX729ipx00729
    • 2021-09-21
    47 min

    C0930 ki210921 Miki Tada 51years old

  • amateur uncensoredc0930
    • 2021-10-01
    102 min

    [SHKD-969]Shameful W Heroin Negotiations Breakdown, Servant Hot Plays - Ema Asahi, An Ayumi

  • chaoyang ema ayumi an censoredbig titsdramaSHKDattackerskinshi yoru akuSHKD-969SHKD969shkd00969
    • 2021-10-01
    122 min

    [MILK-122]She"s Baring Her Basic Instinct When She Preys On Men! Absolutely No Script, No Direction! Pleasure-Crazed, Sweaty, Sweat-Dripping Orgasmic Sex!! Riona Minami

  • rina minami censoredbeautiful girllingerieMILKmilkMILK-122MILK122h-1240milk00122
    • 2021-10-08
    51 min

    [orec-893]みづき(21)

  • amateur censoredcreampieamateurorecorec-893orec893orec-893
    • 2021-10-17
    98 min

    428SUKE-092 [Service Perfect Erotic Beauty Treatment Salon! ] Men’s Beauty Salon Clerk And Pakopako SP Without Renting A Charger! ？？ This Time I Rushed Into The Shop W Massage Around The Lower Body ● Kogingin! Insert The Tide Into The Tide! It&#

  • amateur censoredsquirtingamateursukesuke-092suke092428suke-092
    • 2021-11-08
    61 min

    FC2PPV 2414851 [From FC2] Complete Appearance! Amateur Female College Student [Limited] Reiwa Gal Female College Student Reimi-Chan (21) The Contents Are Super Good. Creampie Raw Squirrel In A Dancer Beauty Body That Is Too Sexy! !! Mecha Ero Di That

  • amateur uncensoredfc2
    • 2021-11-11
    124 min

    [FSDSS-327]My Step-brother Was Away For Three Days. This Is A Record Of Her Moaning And Coming To Life With A Meat Stick Other Than Her Step-Brother"s. Kaname Momojiri

  • kaname momojiri censoredbig titsblowjobFSDSSfaleno2 rentai ritsu 25faleno starFSDSS-327FSDSS3271fsdss00327
    • 2021-11-11
    93 min

    [OKS-123]Mina Konno Wet And Shiny And Tight A Goddess In A Competitive Swimsuit Enjoy The Sight Of A Cute Girl In A School Swimsuit To Your Heart"s Content! Watch Her Change In Peeping Videos, And Check Out Her Tiny Titties, Big Tits, And Her Sha

  • miina konno censoredbeautiful girlsingle workOKSoyaji no kosatsukami sukumizuOKS-123OKS1231oks00123
    • 2021-11-12
    38 min

    359TYVM-208 For A Lewd Wife Who Erects A Nipple While Enchanted By A Fine Cock … ●● Creampie! (Yu Koizumi)

  • amateur censoredcreampiemarried womantyvmtyvm-208tyvm208359tyvm-208
    • 2021-11-19
    225 min

    [HUNTB-143]The Obvious Panty Line From Her Tight Dress Gives Me A Raging Boner!! 2 You Can Totally See All The Neighbor"s Panty Lines Because They All Wear Thin, Tight Dresses

  • censoredcreampielingerieHUNTBhunterkoichi davidsonhhh groupHUNTB-143HUNTB143huntb00143
    • 2021-12-03
    99 min

    [BF-650]Giving A Creampie Load And Slutty Fun To My Vulnerable Younger Step-sis That Always Has A Micro-Bikini On. Misono Mizuhara

  • suwon miso censoredcreampiebig titsBFbefreeBF-650BF650bf00650
    • 2021-12-03
    119 min

    [NNPJ-483]College Girl Free Pussy White Paper 003: Big Titted Kasumi-Chan (18) Is Developing Well . Has Smell Fetish, And Loves Titty Fucks And Blowjobs. Likes Nipple Teasing. First Video.

  • censoredcreampieuniformNNPJnampa japanNNPJ-483NNPJ483nnpj00483
    • 2021-12-31
    178 min

    [MIFD-192]Amateur Who"s Popular With Y********ls Keeps Her Account Name Secret! Meet This Hot New Charismatic Influencer With 80,000 Followers! Porn Debut Of A Beautiful Young Influencer With A Beautiful Face, Hot, Slender Body, And Big Tits! Amu

  • amu kodama censoredbig titsbeautiful girlMIFDmoodyzusa pyonmoodyz freshMIFD-192MIFD192mifd00192
    • 2022-01-10
    93 min

    345SIMM-687 Y-Chan @ Shibuya [Neat / Black Hair / Ponite / Student / Miniskirt / Raw Feet / Beautiful Legs] #Underwear Voyeur #Train Molester #Home Invasion #Sleep Fuck

  • amateur censoredcreampieamateursimmsimm-687simm687345simm-687



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored