big tits def jav javcensored amateur




FC2HDKACHRVMIDEABWVEMASHKDPPPDADNCESDGMEMSSISAWDDASDGVHHNDMIAAHUNTBAVSACAWDVENX

2020-11-02
32 min

FC2PPV 1555221 [There is a happening] When I asked the famous model Norio-chan to write down the brush of the virgin junior … Immediately Iki (laughter) from Iki (laughter) for the first time in life

  • amateur uncensoredfc2
    • 2020-11-18
    120 min

    [GVH-148]Naughty Nurses Kaori Iiyama

  • kaori iiyama censoredcreampiegrandfatherGVHglory questham the mcGVH-148GVH14813gvh00148
    • 2020-11-20
    59 min

    Caribbeancom 112020-001 Fucking All Night Long If I Have A Chance : Continuous Insertion Into A Lady With Outstanding Style! Yui Kisaragi

  • yui kisaragi uncensoredcreampiehandjobcaribbeancom
    • 2020-12-04
    72 min

    [FTBL-007]Popularity Going Up! Her Eyes Sparkle With Power As She Starts Sucking Dick! Slick And Wet From Precum! D***king With A Hookup App Match On A Restaurant Patio？ Straddling A Guy Looking Upwards Welcoming Him With Her Pussy! Slowly Guiding Hi

  • censoredbeautiful girlFTBLfalenodavielfalenotubeFTBL-007FTBL0071ftbl00007
    • 2020-12-08
    118 min

    FC2PPV 1588973 [Personal shooting] Madoka-chan, a big-breasted hairdresser who loves belochu, subjective and objective set

  • amateur uncensoredfc2
    • 2020-12-15
    54 min

    FC2PPV 1607467 [Personal shooting] ♀286 Campaign Gal Hi ◯ Ri-chan 20 years old 1st time A daughter who has no night work experience appears again! A slender superb beauty conceives a vaginal cum shot and ends her life with her AV debut! (LOL)

  • amateur uncensoredfc2
    • 2020-12-15
    119 min

    [ZEX-399](A Private Video Session, Due To, You Know, Reasons) A Real-Life Underground Idol In A Seriously Fucked-Up Offline Meetup Video! She's Having Out-Of-Control, Excessively Creampie Sex With Her Ex LOL Noa Eikawa

  • sakaegawa noa censoredcreampiebeautiful girlZEXpeters maxZEX-399ZEX399h-720zex00399
    • 2020-12-17
    212 min

    [MADV-501]Beautiful Tits, Soft Tits, Colossal Tits - They're All Busty Babes! Prestigious College Girl Orgasmic Creampie Sex - Part-Time POV

  • ena koume rino osaka censoredcreampiebig titsMADVcrystal picturetatsuno kumataromaniac crystalMADV-501MADV50149madv00501
    • 2020-12-17
    149 min

    [PPPD-894]Creampie Soapland Brothel Three-Way - Flanked On Both Sides By Busty Sluts Who'll Drain Your Balls Dry With Unlimited Orgasms

  • marin natsuki manami oura censoredbig titsPPPDoppaiPPPD-894PPPD894pppd00894
    • 2020-12-21
    55 min

    299EWDX-335 A pure wife with a lovely smile and no doubt. Ji ○ port other than the husband who holds for the first time after getting married!

  • amateur censoredcreampiemarried womanewdxewdx-335ewdx335299ewdx-335
    • 2021-01-10
    49 min

    FC2PPV 1640058 [Personal shooting] A lustful wife who has a plump body cuckolded by another stick and drips love juice! [Creampie]

  • amateur uncensoredfc2
    • 2021-01-15
    80 min

    259LUXU-1365 Luxury TV 1353 A beautiful woman dating a wealthy man “to find a man who will satisfy me …” urgently participates in AV shooting! A plump body with plump breasts and buttocks has good sensitivity! Exposing this body in fro

  • amateur censoredbig titsamateurluxuluxu-1365luxu1365259luxu-1365
    • 2021-01-17
    137 min

    [TSF-012]When You Wake Up In The Morning, You Find That You've Been Transformed Into A Domesticated Salary Man Female Bitch (23) A Thorough Investigation He's Been Trained To Be An Obedient Doggy At The Office, And Cannot Disobey Any Order, A

  • ryuhei shimokawa censoredcreampiebig titsTSFkaguyahimept mousouzokugynecomastia reportTSF-012TSF012tsf00012
    • 2021-02-06
    170 min

    [JUL-455]She Might Look Proper, But She's A Secret Sex Fiend Who Gets Off Five Times In One Day And Still Isn't Satisfied - Sakura Miyazono, Age 30, Her Porn Debut!

  • saki miyazono censoredmature womansingle workJULmadonnamametaro mamezawaJUL-455JUL455jul00455
    • 2021-02-15
    245 min

    [NPS-409]Real Pickup! Adorable Girl's First-Ever Orgasm From A Raw Cock! Hip-Shaking Orgasms She'll Remember - The Shudders Won't Stop! 17 Loads! 136 Climaxes!

  • censoredcreampiesquirtingNPSpetersken kikuchinampaNPS-409NPS409h-021nps00409
    • 2021-02-16
    66 min

    [tkwa-155]なつ

  • amateur censoredcreampiesquirtingtkwatkwa-155tkwa155tkwa-155
    • 2021-02-17
    72 min

    [sika-031]こうちゃん(24)

  • amateur censoredcreampieamateursikasika-031sika031sika-031
    • 2021-02-17
    75 min

    [sika-048]りなちゃん 2(18)

  • amateur censoredamateurblowjobsikasika-048sika048sika-048
    • 2021-02-20
    118 min

    [WZEN-043]The Peeping Clan 5 Hinako Yamamoto

  • hinako yamamoto censoredmarried womanWZENwarp entertainmentWZEN-043WZEN0432wzen00043
    • 2021-03-19
    47 min

    FC2PPV 1671733 [Personal shooting] Appearance / Miya 20 years old / I’ve been doing all-you-can-eat, raw squirrel, and vaginal cum shot to a fair-skinned girl with big dicks! !!

  • amateur uncensoredfc2
    • 2021-03-25
    62 min

    413INST-107 ☆ God Lori advent ☆ Cute angel class Lea-chan 19 years old! A naive beautiful girl who has not experienced middle-aged ☆ Gutsun Gutsun Piston FUCK ☆ Suddenly plenty of vaginal cum shot ♪

  • amateur censoredcreampieamateurinstinst-107inst107413inst-107
    • 2021-03-26
    104 min

    [YSN-543]The Smell Of A Precocious Wife - Kanae Kawahara

  • kanae kawahara censoredcreampiesingle workYSNnonYSN-543YSN543h-127ysn00543
    • 2021-03-30
    37 min

    [490FAND4-3]あかり 2

  • amateur censoredamateurbeautiful girlfand4fand4-3fand43490fand4-3
    • 2021-04-06
    122 min

    [KTRA-286]My Big Tits Little Stepsister Lured Me To Temptation With Creampie Sex Akane Shiki

  • akane shiki censoredbig titsuniformKTRAk tribeKTRA-286KTRA286h-094ktra00286
    • 2021-04-14
    150 min

    [SSIS-049]Pretty Y********l With Big Tits Uta Hayano Can't Stop Cumming! First Time 4 Cum Shots

  • hayano uta censoredbeautiful girlsingle workSSISs1 no 1 stylemon cSSIS-049SSIS049ssis00049
    • 2021-04-22
    115 min

    [CHERD-075]"Would You Mind Your First Time Being Raw Sex With An Older Woman？" Virgin Pops His Cherry In The Best Way With A Hot Married Cougar Yumie Kashihara

  • tomie kashihara censoredcreampiemature womanCHERDcenter villagejiro fukagawahanazono center villageCHERD-075CHERD075h-086cherd00075
    • 2021-04-22
    46 min

    FC2PPV 1782306 School swimsuit Rei-chan ☆ Shachihoko sex seeding press cum shot 2 barrage

  • amateur uncensoredfc2
    • 2021-05-27
    64 min

    413INST-125 [Active plump model] Megumi JD2 turned into a meat urinal Outflow Gonzo with entertainment P Gonzo grows with sperm smell OK pussy convulsions metamorphosis real acme video

  • amateur censoredcreampiesquirtinginstinst-125inst125413inst-125
    • 2021-06-02
    123 min

    [GVH-245]A Father In Law And Daughter In Law, Engaged In Hard And Tight Creampie Sex Kanna Misaki

  • kanna misaki censoredcreampiegrandfatherGVHglory questtsunemori takahashiGVH-245GVH24513gvh00245
    • 2021-06-05
    68 min

    200GANA-2499 Seriously Nampa, first shot. 1644 The joy of being blown by a split tongue! Successful pick-up of estheticians with dazzling legs! Frustrated Oma ● Ko is stabbed with cancer and panting as if it was half-baked!

  • amateur censoredamateurganagana-2499gana2499200gana-2499
    • 2021-06-08
    44 min

    FC2PPV 1857125 Until 6/11! Start Discount 3980pt → 1990pt [First] Beautiful Imadoki GAL [Shaving live broadcast] Feeling the chestnut and genital blame that the color and shape are exposed, ◎ Po sucking. Seriously cum on back and missionary insertion

  • amateur uncensoredfc2
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-01
    31 min

    FC2PPV 1898252 [Individual shooting] With permission from her husband. Lending wife’s vagina is too famous and explodes, ejaculation in the vagina without permission [4K video privilege ant]

  • amateur uncensoredfc2
    • 2021-07-07
    106 min

    YRM-006 Hijiri

  • amateur censoredamateurmature womanyrmyrm-006yrm006yrm-006
    • 2021-07-22
    118 min

    [MIAA-478]Ultra-thin Swimsuit Exposing Huge Tits At 3-Day-4-Night Swim Camp-Ena Koume

  • ena koume censoredbig titssingle workMIAAmoodyzhiroaeveryone s porn starMIAA-478MIAA478miaa00478
    • 2021-08-05
    83 min

    374IMGN-018 An (20)

  • amateur censoredamateurbeautiful girlimgnimgn-018imgn018374imgn-018
    • 2021-08-14
    103 min

    [VEC-491]Wife Betrayed By Friend Gets Creampied By Scum, Michiru Kujo

  • kujo michiru censoredcreampiemature womanVECvenuspe tamegami venusVEC-491VEC491vec00491
    • 2021-08-21
    98 min

    300NTK-625 [Asia No.1 Yariman Slender & G Breast Boyne Beauty JD Duo And Greedy Set 4p Special! !! ] Slender International Students Are Hidden Nerds And Dovich Beautiful Girls! !! Two Consecutive Vaginal Cum Shots For The First Time In Japan With

  • amateur censoredcreampieamateurntkntk-625ntk625300ntk-625
    • 2021-08-28
    42 min

    H4610 ki210829 Risa Yanagihara 21years old

  • amateur uncensoredh4610
    • 2021-09-17
    240 min

    [DVDMS-716]A Normal Boys And Girls Focus Group Adult Video A College Girl Big Stepsister And Her Little Stepbrother Are Taking The Thrilling 24-Hour Roulette Life Challenge! This Big Stepsister And Her Little Stepbrother Spin The Wheel And Complete E

  • censoredcreampieamateurDVDMSdeepspoolsidedeep sDVDMS-716DVDMS716dvdms00716
    • 2021-10-08
    244 min

    [VENX-082]Meet The S*****t Council Brats Who Group Fucked Their Hot Teacher And The Sexy PTA Chairwoman Honoka Kimura & Yuri Mizukawa

  • censoredcreampiemature womanVENXvenusincest vi nasuVENX-082VENX082venx00082
    • 2021-10-20
    84 min

    FC2PPV 2360711 Unauthorized Vaginal Cum Shot To A Beautiful G-Cup Beautician! The Sperm That Flows Out In Large Quantities From The Fair-Skinned Beauty Man Is Incredible.

  • amateur uncensoredfc2
    • 2021-10-22
    13 min

    FC2PPV 2363835 [Preparation For Freezing] Bring The Miniskirt K③ On The Way Back From The Concafe Part-Time Job To The Sex Room. Shame With M-Shaped Spread Legs And Demon Ikase With Toys [Washed Out]

  • amateur uncensoredfc2
    • 2021-11-12
    147 min

    [EBOD-869]This Beauty Specialist Is Also A Slut Genius!! She"s Worked At This High-Class Beauty Salon On Omotesando For 4 Years A Currently Active H-Cup Titty Massage Parlor Therapist Makes Her Adult Video Debut Aya Hanasaki

  • aya hanasaki censoredbig titsslutEBODe bodyarashiyama michiruEBOD-869EBOD869ebod00869
    • 2021-12-06
    51 min

    230OREC-947 Miku

  • amateur censoredcreampiebig titsorecorec-947orec947230orec-947
    • 2021-12-09
    54 min

    FCP-058 [Delivery Only] Absolutely Subjective! !! Sperm Is Almost Exhausted! Super Feeling Good! !! Nipple Licking Handjob ＃ 6 (Natural Mizuki Hinata Rina Arisugawa Amane)

  • amateur censoredamateurbeautiful girlfcpfcp-058fcp058fcp-058
    • 2021-12-10
    65 min

    529STCV-041 Mika

  • amateur censoredcreampiebig titsstcvstcv-041stcv041529stcv-041
    • 2021-12-11
    112 min

    [APNS-267]"I"m Sorry I"ve Been Acting Like An Honor S*****t... I"m Really A Masochistic Pervert..." Mashiro Mio

  • mio mashiro censoredcreampieschoolgirlAPNSaurora project annexyukihiro nasuaurora project anexAPNS-267APNS267apns00267
    • 2022-01-01
    108 min

    [XVSR-631]As Soon As My Wife Left On A Business Trip I Spent All Night Fucking Her Adorable Younger Sister Ichika Matsumoto

  • ichika matsumoto censoredcreampiebeautiful girlXVSRmax ak c takedacalenXVSR-631XVSR631xvsr00631
    • 2022-01-10
    59 min

    328HMDN-443 [Ri ○ In Imminent] The Strongest Married Woman In History Has Appeared! !! Cheating Video Leaked With A Beautiful Female Mixed Martial Arts Wife And Coach! !! Quality Beauty Body Big Breasts Wife’s Sweaty Juicy Muscle Creampie Cheati

  • amateur censoredcreampiebig titshmdnhmdn-443hmdn443328hmdn-443
    • 2022-01-29
    139 min

    [DLPN-015]Kiss Me A Lot. Honami (40) Kissing / Married Woman / Amateur / Blowjob / Deep Throat / Squirting / Threesome

  • censoredbig titsblowjobDLPNiruka emmanuelDLPN-015DLPN015dlpn00015
    • 2022-02-05
    152 min

    [MDBK-224]Beautiful Asian International School S*****ts Get Fucked Hard After School Enko/Rika/Ten/Rin

  • censoredschoolgirlslutMDBKk m producejoni shibuyabazookaMDBK-224MDBK224mdbk00224
    • 2022-02-05
    153 min

    [SCOP-756]Younger Step-sister Takes Magic Chems That Look Like Candy And Ends Up Masturbating Like Crazy In Her Step-brother"s Room! She Notices Her Peeping Step-brother And Goes After His Dick To Slobber All Over It In This Fakecest Scenario!

  • censoredsisterSCOPscoopk taromousouzokuSCOP-756SCOP756scop00756
    • 2022-02-09
    240 min

    [270JGAHO-265]熟女画報社B級熟女選手権 倉本雪音 長谷川美沙 松岡瑠実 綾野ゆり子 滝田恵理子

  • amateur censoredcreampieamateurjgahojgaho-265jgaho265270jgaho-265
    • 2022-02-11
    180 min

    [MIAA-579]I Started Living Alone Before Graduation, but My Apartment Became a Gathering Place of Sluts!

  • censoredcreampiebig titsMIAAmoody seighteveryone s kikatanMIAA-579MIAA579miaa00579
    • 2022-02-21
    59 min

    SIRO-4720 [First Shot] [Neat But Lewd] [Gucho Wet Premature Ejaculation Constitution] Excavation Of A Neat Older Sister Who Leaks A Lewd Sigh Just By Kissing And Makes Her Face Swell. If You Leak A Flatulence In A Row With A Chestnut Blame, You Want

  • amateur censoredamateursirosiro-4720siro4720siro-4720



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored