big tits high vision censored hours more best omnibus




FC2ONEZMVSDKBIROYDADNVEMAATIDNACXPPPDDTTHUNTBAPODWAAAHDKAMIDESHKDCESDAWDMEYDNNPJ

2020-12-05
124 min

[NGOD-140]First NTR With A Black Guy: White Peachy Ass And Black Cock - Nozomi Arimura

  • arimura nozomi censoredmature womansingle workNGODjet eizomanji groupNGOD-140NGOD140ngod00140
    • 2020-12-05
    51 min

    210AKO-410 MIKI 2nd

  • amateur censoredanalamateurakoako-410ako410ako-410
    • 2020-12-17
    160 min

    [ROYD-033]My Busty C***dhood Friend Fucked Me For A Whole Week To Protect Me From Bullies. Suzu Kiyomiya

  • kiyomiya suzu censoredbig titsROYDroyalkonjac kanohhh groupROYD-033ROYD033royd00033
    • 2020-12-18
    94 min

    [MBDD-2050]Yume Nikaido In Dirty Diva

  • nikaido yume censoredbeautiful girlMBDDmedia brandMBDD-2050MBDD2050301mbdd02050
    • 2020-12-26
    183 min

    [JUFE-239]She Looks Like An Ordinary Girl, But Nenne-Chan Has H Cup Tits! Super Premature Ejaculation! Juicy Sexual Intercourse Going Crazy As Her Glasses Get Cloudy. First Fuck, With Nenne Hatsuai

  • first love censoredbig titssingle workJUFEfitchJUFE-239JUFE239jufe00239
    • 2020-12-30
    60 min

    Caribbeancom 123020-001 Quick Shooting: The Best of Meirin

  • meirin uncensoredcreampiehandjobcaribbeancom
    • 2020-12-31
    136 min

    [JUL-429]I Want To Be Madam's Bike Saddle - Old Man Saddle Thief Goes After Married Woman With Nice Ass - Nao Shinguji

  • jinguji temple nao censoredmature womansingle workJULmadonnamametaro mamezawaJUL-429JUL429jul00429
    • 2021-01-08
    113 min

    [GNAB-045]This JK Was Staying Late At School And Enjoying Being An Exhibitionist, And When Her Classmate Saw Everything, From Start To Finish, She Was Overcome With The Extreme Pleasure Of Shame, And Started To Piss Herself Silly...

  • censoredschoolgirlGNABprestigebang prestigeGNAB-045GNAB045118gnab00045
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-29
    20 min

    FC2PPV 1664028 Until 1st 2480pt → 1980pt [Personal shooting] Blame a horny married woman with a denma and commit with 4 sticks of others

  • amateur uncensoredfc2
    • 2021-01-30
    95 min

    [HMGL-187]PERFECT STYLE Amu Hanamiya

  • hanamiya amu censoredbig titssingle workHMGLhmjmcompany matsuoglamourHMGL-187HMGL187h-172hmgl00187
    • 2021-02-02
    62 min

    [KBTV-062]Theory: If I Sign A Contract With An Insurance Saleswoman Who Looks She Isn't Getting Many Clients, There's A Good Chance She'll Let Me Fuck Her

  • censoredcreampiebig titsKBTVmessy tvKBTV-062KBTV062h-1514kbtv00062
    • 2021-02-06
    240 min

    [HUNTA-943]"I Can't Do It Anymore! You're Going To Break My Pussy! Pull Out, Please!!" No Matter How Many Times He Cums, This Young And Horny Cherry Boy's Erection Just Keeps On Cumming For More And He Kept On Fucking His Slutty B

  • censoredcreampieblowjobHUNTAhuntervolvo nakanohhh groupHUNTA-943HUNTA943hunta00943
    • 2021-02-12
    301 min

    [SKMJ-148]Beautiful Y********ls In Uniform - First Creampies Encyclopedia - 15 People, 300 Minutes

  • censoreduniformmature womanSKMJred face girlSKMJ-148SKMJ148h-1324skmj00148
    • 2021-02-12
    44 min

    417SRYA-008 I was targeted by a hungry female crocodile! !! There is a woman’s predecessor in the open-air bath … The cock begins to react to the naked female body, straddling the awkward me, and the semen tank is empty due to the angry ero

  • amateur censoredcreampieamateursryasrya-008srya008417srya-008
    • 2021-02-16
    61 min

    FC2PPV 1688871 First shot ❤️ After all, men like this kind of system the most. 【selfie】

  • amateur uncensoredfc2
    • 2021-02-17
    240 min

    [YVG-026]Perverted Slut Loves Licking Public Toilet Seats

  • censoredslutYVGgloryYVG-026YVG02613yvg00026
    • 2021-02-24
    76 min

    SWEET-052 Sakurasaku

  • amateur censoredschoolgirlamateursweetsweet-052sweet052sweet-052
    • 2021-03-06
    41 min

    FC2PPV 1714749 Transcendental Sensitive Girl ♥ Amateur-like Reaction Is Unbearable (> _ <) Cum Inside SEX ♥ * High Quality Version & Review Benefits ♪ [Personal Shooting / Original]

  • amateur uncensoredfc2
    • 2021-03-06
    43 min

    [HHKL-088]Our Parents Have No Idea What's Going On A Big Stepsister And Her Little Stepbrother Are Engaged In Secret Sexual Relations Select.1 Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiesisterHHKLhunterrobby kunhhh groupHHKL-088HHKL088hhkl00088
    • 2021-03-13
    127 min

    [ICIG-001]Barely Legal Amateur Girl 1: Minami #Tiny Tits #Skinny Ribs #Tender Nipples #Wannabe Idol's Secret Sugar Baby Lifestyle Filmed In POV

  • censoredamateurbeautiful girlICIGstrawberry opportunities the daydreammatakichi sarukichiICIG-001ICIG001icig00001
    • 2021-03-18
    120 min

    [C-2622]Day Trip Spa Mature Woman Lust Trip #018

  • aikawa kyouko censoredmarried womanmature womanCgogoskoichi takahashicore gogo sC-2622C2622
    • 2021-03-18
    29 min

    FC2PPV 1731817 Super god style !! The boxed lady is interested and the first Gonzo in her life 2 shots ♡ Good personality and good style

  • amateur uncensoredfc2
    • 2021-03-18
    199 min

    [HUNBL-038]Terrible Fate H

  • censoredcreampiedeepthroatHUNBLhuntergeminihhh groupHUNBL-038HUNBL038hunbl00038
    • 2021-03-25
    137 min

    [NHDTB-509]I Saw A Slut In The Men's Bath 4 - Sudden French Kisses And Passionate Sex - I Couldn't Resist Pumping Her Full Of My Cum

  • censoredcreampieslutNHDTBnatural highbacon tanakaNHDTB-509NHDTB5091nhdtb00509
    • 2021-03-27
    244 min

    [KTKC-110]My Year With A Devilish Amateur With Big K-Cup Tits 7 Videos 4 Hours

  • censoredbig titsamateurKTKCkittyx delusion tribebeef lewd ganovbig titsKTKC-110KTKC110ktkc00110
    • 2021-04-01
    49 min

    10musume 040121_01 Perverted easy girl who became a hyper groovy Kumi Tsukino

  • amateur uncensored10musume
    • 2021-04-09
    117 min

    [IPX-640]Massage Parlor Slut In Lingerie Gently Teases You With Dirty Talk - You Can't Go Home Until You Cum Anna Kami

  • anna kami censoredslutsingle workIPXidea pocketdishIPX-640IPX640ipx00640
    • 2021-04-14
    150 min

    [SSIS-049]Pretty Y********l With Big Tits Uta Hayano Can't Stop Cumming! First Time 4 Cum Shots

  • hayano uta censoredbeautiful girlsingle workSSISs1 no 1 stylemon cSSIS-049SSIS049ssis00049
    • 2021-05-01
    179 min

    [JBD-267]Breaking In A Slut Haruka

  • haruka censoredsingle workJBDattackersusubashisuijabakuJBD-267JBD267jbd00267
    • 2021-05-07
    170 min

    [DASD-856]Devilish Young Female Manager Aims For Victory By Sexually Motivating Her Team Kotone Toa

  • toua kotone censoredschoolgirlsingle workDASDdascognac kaminoDASD-856DASD856dasd00856
    • 2021-05-14
    148 min

    [SSIS-068]Snug And Tight Against Her Tits And Crotch This Elder Sister Type Is Wearing A Knit One-Piece Dress That Hugs Her Curves As She Bats Her Moist Eyes At You, Luring You To Temptation Mei Washio

  • mei washio censoredbig titssingle workSSISs1 no 1 stylekitorune kawaguchiSSIS-068SSIS068ssis00068
    • 2021-05-15
    61 min

    481SACZ-026 Setsuko 2

  • amateur censoredamateurmature womansaczsacz-026sacz026481sacz-026
    • 2021-05-27
    244 min

    [CVDX-450]You Can See Right Through Her Clothes And See Her Alluring Pussy Hairs, Her Nipples, And The Valley Of Her Meaty Ass ... A Married Woman Will Lure You With The Temptation Of See-Through Lingerie Sex 30 Ladies 4 Hours

  • censoredcreampiemarried womanCVDXcenter villageCVDX-450CVDX450h-086cvdx00450
    • 2021-05-28
    49 min

    328HMDN-366 Dero Married Woman With A Child Who Flocks On SNS 31 Years Old Erotic Buzzing Mature Milk H Cup Rubbing New Toy Saddle "Gimojiii" Raging Big Cock Portio Thrust Cum Shot Completely Fallen

  • amateur censoredcreampiebig titshmdnhmdn-366hmdn366328hmdn-366
    • 2021-06-06
    36 min

    FC2PPV 1855564 [Personal shooting] ♀299 Professional student Ma ◯ -chan, 20 years old, 2nd time, will you get pregnant once! ？？ Menstruation stopped at the last seeding conceived AV debut! A vaginal cum shot that doubles as a pregnancy test! (Lol)

  • amateur uncensoredfc2
    • 2021-06-24
    200 min

    [SVDVD-863]Hold Out And Win A Prize! If You Fail It's Instant Penetration By Huge Cock! Teen College Girl Squatting Face Sitting Cunnilingus Challenge! She Cum And Squirts Over And Over Again As The Hood On Her Sensitive Clit Is Peeled Back And L

  • censoredcreampiesquirtingSVDVDsadistic villagenew kazi kazamaamateur participation varietySVDVD-863SVDVD8631svdvd00863
    • 2021-07-01
    85 min

    435MFC-120 ["It feels better than your sister？"] Renka and raw SEX with twin erotic sisters who take pride in their feelings more than their sister Ma ● Ko! [Shiroto Gonzo ＃ Renka ＃ 24 years old ＃ Slender big tits]

  • amateur censoredcreampieamateurmfcmfc-120mfc120435mfc-120
    • 2021-07-10
    130 min

    [BADA-017]Married Woman Masochist Training Club Akari Niimura

  • akari shinmura censoredsingle workbukkakeBADAbaltanusubashisuidiamondBADA-017BADA017bada00017
    • 2021-07-14
    57 min

    510ELLO-012 Concafe Nampa Mikuru chan

  • amateur censoredamateurelloello-012ello012510ello-012
    • 2021-07-17
    238 min

    [CJOB-091]Squeezing Out Your Cum In Her Mouth And Pussy! The Most Erotic Gal In The World! BEST

  • aika natsuho imai censoredcreampieblowjobCJOBchijo heavenslut heaven bestCJOB-091CJOB091cjob00091
    • 2021-08-06
    163 min

    [IPIT-020]Adoration For Japanese Porn! A Half Swedish Beautiful Girl Who Loves The Showa Period Makes Her AV Debut. Uika Noa

  • squid censoredsquirtingblowjobIPITidea pocketmamezawa mametarouaipoke itsuzai hakkutsu projectIPIT-020IPIT020ipit00020
    • 2021-08-07
    165 min

    [MKMP-410]"Hey ... Today, I Want You To Let Me Do Whatever I Want To Your Nipples, Just For Today ..." Genuine Nipple Sex That Never Ends, Even If The Sky Starts Spinning Lena Aoi

  • blue censoredcreampieblowjobMKMPk m producesamoarimillionMKMP-410MKMP410mkmp00410
    • 2021-08-21
    240 min

    [GIGL-656]From-Above Footage: Cheeky Married Woman Coming From The Piston Action Of A Weakling

  • censoredblowjobGIGLgigolo jigorogigoloGIGL-656GIGL656gigl00656
    • 2021-09-07
    19 min

    FC2PPV 2172443 [Gonzo] Voice Kawa F Cup! Summoning Me … It’s A Hassle, I’ll Make It Easier [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-09-10
    124 min

    [JUL-705]After The Graduation Ceremony ... Your Stepmom Is Giving You A Gift To Celebrate Your Entry Into Adulthood ... A Madonna Label Exclusive Beautiful Mature Woman Actress Is Celebrating Your Launch Into The Real World With Her Alluring Eroticis

  • hojo asahi censoredcreampiemature womanJULmadonnahimu lockJUL-705JUL705jul00705
    • 2021-09-10
    119 min

    [JUL-702]It"s Been A Year And A Half Since Her Debut ... The Long-Awaited Lifting Of Her Creampie Ban!! After Every Time She Has Babymaking Sex With Her Husband, She"s Been Continuously Creampie Fucked By Her Father-In-Law ... Rena Kodama

  • kodama rena censoredcreampiebig titsJULmadonnarokusaburo mishimaJUL-702JUL702jul00702
    • 2021-09-24
    125 min

    [ZKWD-018]The After-School Human Toilet #18 Aya Sakai

  • ayami sakai censoredcreampiesingle workZKWDtoyohikozarakiyasushiun kaiZKWD-018ZKWD018zkwd00018
    • 2021-09-25
    40 min

    450OSST-015 She’s An Older Sister Found In Korea, And She’s A Genuine Bitch Who Sprinkles Three Times A Week! Chestnut & Nipple Alive With Electric Attack! "Denma, Big Love! Japan, Big Love!"

  • amateur censoredamateurslutosstosst-015osst015450osst-015
    • 2021-10-22
    119 min

    [JUL-756]My Bully Fucked My Mom Asahi Mizuno

  • mizuno chaoyang censoredbig titsmature womanJULmadonnakawaijou osamuJUL-756JUL756jul00756
    • 2021-10-23
    103 min

    [AGAV-066]Poetic Lolita Confinement Fuck, Ichika Kasagi

  • kasagi ichika censoredcreampiesquirtingAGAVsex agentyuuki mogeraAGAV-066AGAV066agav00066
    • 2022-01-01
    185 min

    [SORA-355]A Blowjob Buddy Cum Swallowing Date Go On A Date With A Skinny, Tiny Titty Exhibitionist JK With An Absolutely Bangingly Good, Sensitive Body She"ll Lead Trembling Boys As She Gets Rocking For 5 Big Time Cum-Sucking Ejaculations!! Yui N

  • yui nagase censoredschoolgirlblowjobSORAyama to soratelephone poleSORA-355SORA355sora00355
    • 2022-01-03
    67 min

    SIRO-4745 [First Shot] [Baby Face Slender] [Systemic Erogenous Zone] A Minimal Jd With A Glittering Smile That I Applied For With My Twin Sister. When An Innocent Facial Expression Swells With Pleasure And Dies While Cramping A Delicate Body .. AV Ap

  • amateur censoredamateursirosiro-4745siro4745siro-4745
    • 2022-01-06
    128 min

    [AKDL-159]My Sister-in-Law Jacked Me Off Like Crazy Until She Emptied Out My Balls.

  • natsuki kisaragi sakura tsuji censoredcreampieslutAKDLakinoriakinoriaknrAKDL-159AKDL1591akdl00159
    • 2022-02-05
    41 min

    210AKO-452 SAYA 2nd Shot (Saya Niiyama)

  • amateur censoredsquirtingamateurakoako-452ako452210ako-452
    • 2022-02-15
    79 min

    [ACZ-074]Kyoko, The Virgin Servant [An Edition Of Orgasms From The Power Of Suggestion]

  • censoredACZsanwa publishingabnormal.companiesACZ-074ACZ074h-019acz00074



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored