big tits jav celebrity javcensored high vision




FC2ABWWANZMIDVATIDSQTESHKDCAWDPPPDNATRSANMARAHNDMEYDHDKAONEZAUKGRBDAUKSMIDEADN

2019-11-14
210 min

[SSNI-618]Total Domain A Voluptuous Thighs In Uniform Peek-A-Boo Show A Bare-Legged Idol In The Ultimate Temptation A Little Devil Beautiful Girl In Knee-High Socks Yua Mikami

  • yua mikami censoredbig titssingle workSSNIs one number one stylebungo maedas1 no 1 styleSSNI-618SSNI618ssni00618
    • 2019-11-09
    170 min

    [IPX-399]She's Luring You To Temptation With Her Revealing Swimsuits! This Little Devil Gravure Idol Momo Is Wiggling And Jiggling Her Titties In An Unstoppable Ejaculation Cowgirl Fuck Fest! Momo Sakura

  • sakura sky momo censoredbig titsschoolgirlIPXidea pocketusa pyondishIPX-399IPX399ipx00399
    • 2019-11-08
    136 min

    [ABP-921]Minamo Nagase Raw Creampie Sex 32 8 Babymaking Cum Shots Into The Pussy Of A G-Cup Titty Idol!!

  • minase nagase censoredcreampiebig titsABPprestigemichiru sanabsolutely perfectABP-921ABP921118abp00921
    • 2019-10-31
    92 min

    [ENFD-4301]秘蜜 金子智美

  • tomomi kaneko censoredbig titsbeautiful girlENFDpig roomENFD-4301ENFD43015671enfd04301
    • 2019-10-29
    79 min

    [MBRBA-047]声優志望のアニヲタ18歳は童顔巨乳！ 安達加恋

  • adachi censoredbig titssingle workMBRBAspice visualMBRBA-047MBRBA0475050mbrba00047
    • 2019-10-27
    146 min

    [FONE-087]Talent Production A - G-Cup - Mia

  • censoredcreampiebig titsFONEfirst starplus first starFONE-087FONE087h-491fone00087
    • 2019-10-25
    230 min

    [SKMJ-070]Picking Up Real Amateurs, For Real! Please Introduce Us To One Of Your Friends, And Make Sure She's Hornier Than You! In Roppongi A Celebrity Friend Circle Special

  • censoredcreampiebig titsSKMJred face girlkikukawaSKMJ-070SKMJ070h-1324skmj00070
    • 2019-10-24
    120 min

    [FSDSS-001]A Fresh Face A FALENO STAR Exclusive The Gravure Idol, Full Of Innocence Her Adult Video Debut Minami Ikuta

  • ikuta minami censoredbig titsbeautiful girlFSDSSfalenofaleno starFSDSS-001FSDSS0011fsdss00001
    • 2019-10-12
    149 min

    [SSNI-589]Noa Mikami Is Cumming With All Her Might

  • yua mikami censoredbig titsslutSSNIs1 no 1 stylecrestSSNI-589SSNI589ssni00589
    • 2019-10-12
    240 min

    [FONE-085]An Underground Market Exists Even In The Idol Industry Beautiful Girl Sexual Services 4 Hours

  • censoredcreampiebig titsFONEfirst starplus first starFONE-085FONE085h-491fone00085
    • 2019-10-12
    148 min

    [SSNI-599]199 Intense Orgasms! 4800 Convulsions! 10000cc Of Ejaculate! Entertainer with Natural SEX Talent Marin Hinata Erotic Awakenening: First Big/Spasm/Convulsion Special

  • marin hinata censoredbig titssquirtingSSNIs1 no 1 stylemichiru arashiyamaSSNI-599SSNI599ssni00599
    • 2019-10-10
    559 min

    [STCESD-078][Special Value Combo] A Lovey Dovey Date Yu Kawakami Ryoko Murakami A Serious Adultery Love Date 4 Hitomi Enjoji

  • kawakami yuu murakami ryoko censoredbig titsmature womanSTCESDceleb no tomocelebrity friends bargain setSTCESD-078STCESD078stcesd00078
    • 2019-10-10
    119 min

    [XMOM-011]A Voluptuous Celebrity Wife Is Drinking Down Every Last Drop Of My Semen! Kanna Shinozaki

  • kina shinozaki censoredcreampiebig titsXMOMcenter villagetenunsighing at sexXMOM-011XMOM011h-086xmom00011
    • 2019-10-06
    152 min

    [MIFD-085]AV Ban Lifted! Constricted Big Tits Beauty Non-Nude Erotic Idol Fierce Debut! Iori Arisu

  • arisa iori censoredbig titssingle workMIFDmoody susapyonmoodyz freshMIFD-085MIFD085mifd00085
    • 2019-09-28
    126 min

    [HMGL-178]A Big Ass Scandal The Sex Idol 2 Mizuki Hayakawa

  • mizuki hayakawa censoredbig titssingle workHMGLhmjmcompany matsuoglamourHMGL-178HMGL178h-172hmgl00178
    • 2019-09-27
    242 min

    [SIV-039]AMATEUR TV x PRESTIGE PREMIUM 36 Amateur Idols In First-Time Videos, Filmed Casually Like It's Part Of Their Part-Time Job!

  • censoredbig titsamateurSIVprestigeshiroto tvSIV-039SIV039118siv00039
    • 2019-09-14
    219 min

    [SSNI-566]She's So Kind And Gentle, She'll Service You With Sex!! A Legendary Titty Pub Idol Sorry If She's All Booked Up! An 8-Fuck Special Yua Mikami

  • yua mikami censoredbig titssingle workSSNIs1 no 1 stylezaku araiSSNI-566SSNI566ssni00566
    • 2019-09-14
    169 min

    [SSNI-575]Pissing/Squirting/Squirting Splatters A Celebrity Has A Massive, Massive, Massive Flooding Orgasm Marin Hinata

  • marin hinata censoredbig titssquirtingSSNIs1 no 1 stylekyoseiSSNI-575SSNI575ssni00575
    • 2019-09-08
    151 min

    [MEYD-525]She's Lifting Her Creampie Ban! A Former Celebrity H-Cup Big Tits Married Woman Is Prepared To Get Pregnant As She Takes On 3 Creampie Fucks Nanao Nakano

  • nanao nakano censoredcreampiebig titsMEYDtameike goroMEYD-525MEYD525meyd00525
    • 2019-09-08
    719 min

    [MIZD-153]Shoko Takahashi First BEST 12 Titles 720 Minutes

  • shoko takahashi censoredbig titssingle workMIZDmoodyzmoodyz bestMIZD-153MIZD153mizd00153
    • 2019-08-31
    239 min

    [MIDE-678]The Gravure Idol Was Forbidden From Dating, So I Could Never Let Anyone Know About Our Lovey Dovey Sex Life Together Shoko Takahashi

  • shoko takahashi censoredbig titssingle workMIDEmoodyzkyoseimoodyz divaMIDE-678MIDE678mide00678
    • 2019-08-27
    139 min

    [NINE-021]This Bewitchingly Beautiful Celebrity From Ashiya Is A Grade A5 Ripe And Ready K-Cup Titty Piece Of Chateaubriand Ass

  • censoredbig titsmature womanNINEmercuryninniku tarochateaubriand hutNINE-021NINE021h-1133nine00021
    • 2019-08-16
    152 min

    [SSNI-542]Class Reunion Cuckolding - My Beloved Wife And Her Asshole Ex-Boyfriend Reignite Their Old Flame - Yua Mikami

  • yua mikami censoredbig titssingle workSSNIs1 no 1 styleamazing meatSSNI-542SSNI542ssni00542
    • 2019-08-16
    240 min

    [MBMH-009]A Mind-Blowing Eros Company Black Hole Furious Lesbian Love With The Ultimate Delicious Boneless Body! A Beautiful Colossal Tits Celebrity Mature Woman 24 Hours A Day, She's Pleasuring Her Partners At This Secret Apartment For Women Onl

  • censoredbig titslesbianMBMHprestigegaro sasazukambmMBMH-009MBMH009118mbmh00009
    • 2019-08-16
    150 min

    [SSNI-553]Pleasure! First Experiences 6 We're Letting You Luxuriate With A Celebrity In 3 Shameful Extremely Orgasmic Fucks 150 Minutes An Orgasm-Filled Special Marin Hinata

  • marin hinata censoredbig titssquirtingSSNIs1 no 1 stylemon cSSNI-553SSNI553ssni00553
    • 2019-08-12
    149 min

    [FONE-076]A Big Tits Underground Idol 3 Fucks On Her Way To The Top Noa

  • censoredbig titsFONEfirst stardiscoveryFONE-076FONE076h-491fone00076
    • 2019-08-10
    147 min

    [MEYD-516]Pumped 7200 Times, She Spasms 269 Times And Squirts 4600 CCs Of Fluid - She Screams As She Gets Fucked 3 Times And Sprays Sweat, Saliva And Pussy Juice Everywhere! - Nao Nakano

  • nanao nakano censoredbig titssquirtingMEYDtameike goromon cMEYD-516MEYD516meyd00516
    • 2019-07-13
    213 min

    [SSNI-516]While My Girlfriend Was Away On Vacation, I Was Fucking Her Childhood Friend From Morning Until Night A 48-Hour Video Record Of My Infidelity Yua Mikami

  • yua mikami censoredbig titssingle workSSNIs1 no 1 stylebungo maedaSSNI-516SSNI516ssni00516
    • 2019-07-13
    149 min

    [SSNI-528]Fresh Face NO.1 STYLE The Celebrity Marin Hinata Her Adult Video Debut

  • marin hinata censoredbig titssingle workSSNIs1 no 1 stylemon cSSNI-528SSNI528ssni00528
    • 2019-07-12
    149 min

    [FONE-070]A Big Tits Underground Idol Futaba Leaked Videos From The Photo Shoot

  • censoredcreampiebig titsFONEfirst starbig tits first starFONE-070FONE070h-491fone00070
    • 2019-06-28
    240 min

    [SIV-038]Amateur TV x PRESTIGE PREMIUM 35, Amateur Idols In Their First Video Taken As If It Was Part Of Work!

  • censoredbig titssquirtingSIVprestigeshiroto tvSIV-038SIV038118siv00038
    • 2019-06-27
    122 min

    [FONE-066]Non-Nude Erotic Model, Petite But With Colossal Tits, Suddenly Finds Herself Filming A Porno

  • censoredcreampiebig titsFONEfirst starbig tits first starFONE-066FONE066h-491fone00066
    • 2019-06-15
    174 min

    [SSNI-493]S&M Debut National Idol Fully Bound And Forcefully Violated Yua Mikami

  • yua mikami censoredbig titsbdsmSSNIs1 no 1 stylekyoseiSSNI-493SSNI493ssni00493
    • 2019-06-15
    154 min

    [PPPD-769]Non-Stop Screaming Orgasms - A Creampie Spa Trip with a Big-titted Beauty: Ruka Inaba

  • inaba censoredcreampiebig titsPPPDoppaiPPPD-769PPPD769pppd00769
    • 2019-06-08
    150 min

    [EBOD-697]She Was Wearing An Outfit With Her Nipples And Pussy Peeking Out, And That Got Me Super Excited... A Perverted Girl Who Likes Being An Exhibitionist A 19-Year Old Innocent Pair Of Titties A Real-Life Sexy Costume Non-Nude Erotica Idol Makes

  • yukimi chinatsu censoredbig titssingle workEBODe bodyEBOD-697EBOD697ebod00697
    • 2019-05-11
    166 min

    [IPX-315]From A School In T City, Chiba, A Former Member Of The Underground Pop Group K Makes Her Porn Debut. Rui Otoha

  • rui otowa censoredbig titsbeautiful girlIPXidea pocketmanbo nishinakajimadishIPX-315IPX315ipx00315
    • 2019-04-13
    209 min

    [SSNI-452]Made To Model Lingerie... Fetishism 9 Lingerie Special. Yua Mikami

  • yua mikami censoredbig titslingerieSSNIs1 no 1 stylebungo maedaSSNI-452SSNI452ssni00452
    • 2019-04-07
    149 min

    [EBOD-688]Real Life Idol Cums For The First Time! 4 Videos Of Her H Cups Bouncing As She's Fucked Ruka Inaba

  • inaba censoredbig titssquirtingEBODe bodyEBOD-688EBOD688ebod00688
    • 2019-04-05
    194 min

    [CHN-171]Renting New Beautiful Women 89 Minamo Nagase (An Adult Video Actress, And Former Idol) 20 Years Old

  • minase nagase censoredbig titssquirtingCHNprestigemanhattan kimurakashiCHN-171CHN171118chn00171
    • 2019-03-16
    177 min

    [SSNI-432]I'm That Scumbag Who Gives Into Temptation When My Girlfriend's Busty Little Sister Provokes Me With Her Bra-Less F-Cup Tits. Yua Mikami

  • yua mikami censoredbig titssisterSSNIs1 no 1 stylekyoseiSSNI-432SSNI432ssni00432
    • 2019-03-10
    120 min

    [EBOD-683]A Massive Fresh Face E-BODY Exclusive Debut An Exquisite H-Cup Titty Real Idol With Beautiful Tits Ruka Inaba She's Lifting Her Adult Video Ban

  • inaba censoredbig titsbeautiful girlEBODe bodyEBOD-683EBOD683ebod00683
    • 2019-03-06
    479 min

    [OFJE-189]Yua Mikami. 2-Year Anniversary Compilation. All 12 Of Her Latest Titles. 73 Segments. 480-Minute Special

  • yua mikami censoredbig titsbeautiful girlOFJEs1 no 1 styleOFJE-189OFJE189ofje00189
    • 2019-01-30
    425 min

    [STCESD-061][Special Value Combo] A Members Only Wetting Yourself Bar This Office Lady Lives In A Tiny Apartment Without A Bathroom And is Wetting Yourself A Big Tits Office Lady Is Unstoppably Pissing And Wetting Yourself Yuri Oshikawa Miho Tono Mao

  • yuri sugawa miho tsuno censoredcreampiebig titsSTCESDceleb no tomocelebrity friends bargain setSTCESD-061STCESD061stcesd00061
    • 2019-01-26
    85 min

    [BTHA-021]Uncensored Hair Nudes A Relaxing Type Beauty With I-Cup Beautiful Big Tits Natsuko Mishima

  • natsuko mishima censoredbig titssingle workBTHAspark visionBTHA-021BTHA0215433btha00021
    • 2019-01-24
    74 min

    [BAGBD-089]Hidden Beauties Revolution Nodoka Sakuraha

  • sakuraha nodoka censoredbig titsbeautiful girlBAGBDbaguschikara sawamuraBAGBD-089BAGBD089h-305bagbd00089
    • 2019-01-17
    124 min

    [SSNI-388]Yua Mikami In A 16-Consecutive Cum Shot Slut Assault She's Tied Up Men For Some Energy-Sucking Forced Ejaculations

  • yua mikami censoredbig titsslutSSNIs1 no 1 styleichigoharaSSNI-388SSNI388ssni00388
    • 2019-01-12
    124 min

    [EBOD-676]Sexy Underwear Model Finally Agrees To Porn Debut! Kaoru Matsuzawa

  • satoshi matsuzawa censoredbig titsblowjobEBODe bodyEBOD-676EBOD676ebod00676
    • 2019-01-10
    64 min

    [BAGBD-088]Hidden Beauties Revolution Ai Inoue

  • ai inoue censoredbig titsbeautiful girlBAGBDbagustakashi kadoyaBAGBD-088BAGBD088h-305bagbd00088
    • 2018-12-22
    178 min

    [MIDE-608]Her First Cherry Boy Sex Session An Orgasmic Special Shoko Takahashi

  • shoko takahashi censoredbig titssingle workMIDEmoodyzmoodyz divaMIDE-608MIDE608mide00608
    • 2018-12-17
    82 min

    [PPMNB-081]Innocent Nip Slip G Cup! Asami Fujishiro

  • asami fujishiro censoredbig titssingle workPPMNBintec incashitamaeshiiPPMNB-081PPMNB081h-706ppmnb00081
    • 2018-12-17
    84 min

    [THNIB-026]Beautiful Girl 150 cm Tall, G Cup Tits, Who Looks Like A Little Sister. Misuzu Morisaki

  • misuzu morisaki censoredbig titsbeautiful girlTHNIBintec incthree nineTHNIB-026THNIB026h-706thnib00026
    • 2018-12-17
    64 min

    [HAHOB-019]Shameful Nudism -G Cup Shows It All- Arisa Yoshinaga

  • arisa yoshinaga censoredbig titssingle workHAHOBintec inchapiness holicHAHOB-019HAHOB019h-706hahob00019
    • 2018-12-16
    180 min

    [NNPJ-312]Mai Is A Slender Escort And Bikini Model From Nagoya With G-Cup Tits Who Often Services A Certain Popular Male Pop Idol Group. We Followed Her For 31 Days, During Which She Had Sex With A Handsome Player Who Filmed The Sex, Ultimately Leadi

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-312NNPJ312nnpj00312
    • 2018-12-14
    120 min

    [MKMP-253]This Celebrity Wife Who Wanted To Get Her Wayward Son Into School By Any Means Possible, So She's Offering Up Her Body As Payment Chie Nakamura

  • tomoe nakamura censoredcreampiebig titsMKMPk m producesuisei akaimillionMKMP-253MKMP25384mkmp00253
    • 2018-12-14
    130 min

    [TMCY-119]Sleeping Her Way To The Top

  • misa morishita censoredbig titsbeautiful girlTMCYbaltanTMCY-119TMCY119h-452tmcy00119
    • 2018-12-10
    72 min

    [MMKTB-003]Erina Kawamura Please Don't Tickle My Titties

  • erina kawamura censoredbig titsschoolgirlMMKTBmedia marketMMKTB-003MMKTB0035448mmktb00003



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored