big tits school uniform creampie censored jav




FC2AUKGNACRFSDSSGMEMSPRDMIAAMARAWAAAVENUAUKSAVSAPREDCJODADNGVHWANZSHKDNATRLULUHZGD

2020-10-03
94 min

[ADN-269]I Tried To Get An Interview Without An Appointment With This Former Big Time Businessman Who Never Granted Access To Reporters, But Not Only Did He Fuck Me, He Took Over My Body And Soul. Mami Nagase

  • asami nagase censoredsingle workADNattackerssayaka dateotona no dramaADN-269ADN269adn00269
    • 2020-10-08
    85 min

    [ykmc-036]かほ(22)

  • amateur censoredcreampiebig titsykmcykmc-036ykmc036ykmc-036
    • 2020-10-11
    243 min

    [VOSS-200]"No Way Are You Seducing Me？" I Got A Full Erection For My Defenseless Busty Step Mother Wearing My White Shirt With No Bra! 4 Hour Edition. When I Woke Up In The Morning, Only Mom Was S******g Naked. Those Unprotected Tits Peeking

  • censoredcreampiemature womanVOSSvenusthe matures projectVOSS-200VOSS200voss00200
    • 2020-10-15
    59 min

    FC2PPV 1534555 [No / Amateur] A 20-year-old tall beautiful office lady with cute eyes and a shy feeling gradually … ♥ At the end, she seems to cry inside …

  • amateur uncensoredfc2
    • 2020-10-25
    30 min

    S-Cute 793_shizuku_03 Creampie H to a baby-faced beautiful girl / Shizuku

  • shizuku censoredcreampieamateurshizukushizuku-03shizuku03793-shizuku-03
    • 2020-10-29
    62 min

    336KNB-126 Caress the young wife who is unsatisfied with the rut SEX with her husband. The fascinating whip and nice ass are nailed so that they can be popped with each piston! !! I will take a gonzo with this married woman from now on. 22 at Nanasat

  • amateur censoredmarried womanamateurknbknb-126knb126336knb-126
    • 2020-10-29
    60 min

    [SIROR-034]The Work Of A Mature Woman For Rent - A Wife's Other Face, Unknown To Her Husband file NO.34 -

  • censoredcreampiebig titsSIRORdispatched.comSIROR-034SIROR034h-1492siror00034
    • 2020-11-04
    88 min

    435MFC-051 Yuriasan (27)

  • amateur censoredbig titsamateurmfcmfc-051mfc051435mfc-051
    • 2020-11-07
    95 min

    [DBVB-032]A Cross-Dresser In Sensual Oily Orgasmic Hell When His Mind Is Blown, His Lusty Body Will Continue To Spasm And Twitch With Pleasure

  • satsuki takahashi himena censoredanalDBVBbabyentertainmentvenus babyDBVB-032DBVB032dbvb00032
    • 2020-11-23
    119 min

    [OPPW-078]My Would-Be Girlfriend Turned Me Down Because She's A Lesbian, So Decided To Cross Dress Itsuki Amane

  • rain sound censoredsingle workOPPWopenipeni world mousouzokuumanosukeOPPW-078OPPW078oppw00078
    • 2020-11-30
    75 min

    484SD-002 If you talk to a gal who was dancing while drinking in front of the station, the super famous Tik T ○ ker will be listed in the ranking! ？？ Let’s take a picture with a camera! He was a super erotic dancer who would blow up to the tide

  • amateur censoredsquirtingamateursdsd-002sd002484sd-002
    • 2020-12-24
    241 min

    [ZOOO-015]20 Ladies With Exquisite Bodies 2 240 Minutes With Beautiful Ladies With Beautiful Big Tits And Faces That Alone Would Be Enough To Provide You With Ample Nookie

  • aika kimishima mio censoredbig titsZOOOzoooZOOO-015ZOOO015h-1515zooo00015
    • 2021-01-08
    150 min

    [HODV-21540]Peeping At A Married Woman's Adulterous Love Affair Through The Rear Window - Reika Hashimoto

  • reika hashimoto censoredsingle workHODVh m pHODV-21540HODV215405642hodv21540
    • 2021-01-11

    FC2PPV 1616208 [Personal shooting] Miso 20 years old Selfie masturbation remastered version [Limited time]

  • amateur uncensoredfc2
    • 2021-01-11
    42 min

    362SCOH-031 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [Ze ● Two]

  • amateur censoredcreampieamateurscohscoh-031scoh031362scoh-031
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-22
    50 min

    [oretd-832]AYA

  • amateur censoredcreampiebig titsoretdoretd-832oretd832oretd-832
    • 2021-01-26
    99 min

    FC2PPV 1660324 [No / Amateur individual shooting] Ikareta bottomless sexual desire like an erotic manga Creampie sex with a wife and outdoor exposure with public exposure! This is a genuine nympho, withdrawal symptom that convulsions when too lustful

  • amateur uncensoredfc2
    • 2021-01-29
    50 min

    [per-360]ひまり

  • amateur censoredamateurblowjobperper-360per360per-360
    • 2021-02-27
    90 min

    FC2PPV 1702653 Celebration! A total of over 20,000 thank-you projects! [Big Cock Big Mara Subordinate x Miraculous Beauty BODY Beauty and 3P] The daughter of the president’s daughter has also grown up w Drinking with 3 people and getting drunk a

  • amateur uncensoredfc2
    • 2021-02-27
    121 min

    [WAAA-038]"Huh？! Did You Just Cum Inside Me？!" - He Tries To Cover Up His Premature Ejaculation By Continuing To Piston Fuck Her Even After He's Cum!! - Sora Minamino

  • minano sora censoredcreampieschoolgirlWAAAwanz factorywanzWAAA-038WAAA038waaa00038
    • 2021-03-10
    67 min

    FC2PPV 1720568 Shocking [brood parasite] Slender beautiful wife 35 years old SNS ＃ SEX with a raw gonzo shot of a wife who came with sperm donation. Continuous seeding Ahegao without pulling out to the powerful SEX of the unequaled cock younger than

  • amateur uncensoredfc2
    • 2021-03-13
    117 min

    [DASD-826]The Girl I Met On The Train That Day Was A Weird Slut. Wan Horikita

  • horikita wan censoredschoolgirlblowjobDASDdasrokusaburo mishimaDASD-826DASD826dasd00826
    • 2021-03-20
    102 min

    300MAAN-635 [Trauma-class brush wholesale experience! A lustful beauty makes a virgin a demon! ] Big breasts H cup sexually strong girlfriend (24 years old: working at a cosmetics company)! It’s designed by my boyfriend and I’m grateful! Di

  • amateur censoredcreampiebig titsmaanmaan-635maan635300maan-635
    • 2021-03-26
    104 min

    [YSN-543]The Smell Of A Precocious Wife - Kanae Kawahara

  • kanae kawahara censoredcreampiesingle workYSNnonYSN-543YSN543h-127ysn00543
    • 2021-04-01
    145 min

    [278GNAB-051]休憩時間中の美脚ナースに「リモバイ」を着けて10分耐えたら謝礼をもっとあげますとお願いしたところ…

  • amateur censoredamateurgnabgnab-051gnab051278gnab-051
    • 2021-04-02
    243 min

    [HODV-21568]Mitsuki Nagisa Best

  • scooping censoredcreampiecosplayHODVh m pHODV-21568HODV215685642hodv21568
    • 2021-04-08
    152 min

    [MIST-334]Ass Hell - This Sadistic Slut Will Moisten Her Throat With Your Semen By Luring You To Her Breaking In Room In This Towering Condominium And Plant Her Big Spouting Ass Onto You And Turn You Into A Chair With A Cock So That She Can Squeeze A

  • misono waka censoredslutMISTmr michirurusher miyoshiMIST-334MIST3341mist00334
    • 2021-04-14
    208 min

    [HUNTA-989]Cramped In A Tiny Tub Together! Mixed Bathing With Knock Out Hotties (You C***dhood Friend, Your Stepsister, Your Stepmom)! Their Bare Titties Are Even Prettier Than You Imagined, And So Soft...

  • censoredcreampieblowjobHUNTAhuntermorikihhh groupHUNTA-989HUNTA989hunta00989
    • 2021-04-15
    240 min

    [OKAX-727]This Normal Housewife Went To A Massage Therapist (An Acquaintance Of Her Husband) To Get Some Filthy Treatment And It All Led To Sex, As Evidenced By This Thrilling Documentary! 4 Hours

  • censoredmarried womanamateurOKAXkm producedick poisonside dishesOKAX-727OKAX727okax00727
    • 2021-04-17
    119 min

    [MISM-199]Finally Ready For Anal - Masochist Girl Cums Hard For Back Door Fucking Kasumi Hanasaki

  • kasumi hanasaki kanna flower censoredanallesbianMISMm girls labinaballMISM-199MISM199mism00199
    • 2021-04-20
    242 min

    [SDAM-061]We Met This Married Woman On A Trip With Her Friend To The Ishiwa Hot Spring Resort Would You Go Into The Men's Bath Wearing Only A Towel？ They Were So Excited, They Got Non-Stop Erections "Give Their Cocks A Good Scrubbing With You

  • censoredmarried womanmature womanSDAMsod createchain sectsodSDAM-061SDAM0611sdam00061
    • 2021-05-08
    137 min

    [NITR-507]Slutty Wife With Plump Body Is Crazy For Dick IV Yuria Yoshine

  • yoshine yuria censoredcreampiebig titsNITRcrystal eizonitroNITR-507NITR507nitr00507
    • 2021-05-15
    126 min

    [TIKB-109]Video Records Of A Perverted Older Man The Feel Of Sexy Asses Nontan Kanon Ibuki

  • kanobuki censoredbig titssingle workTIKBtikitiki.comerTIKB-109TIKB109tikb00109
    • 2021-05-15
    105 min

    300NTK-565 Celebration! !! Newcomer! !! The style is too good and the whitening boyne beauty is full of ethics. !! I want to be buried in the lust of Echikos Bunny, a beautiful gorgeous bubbly! !! De Nasty Ma ○ Ko who accelerates the chain with a fri

  • amateur censoredcreampieamateurntkntk-565ntk565300ntk-565
    • 2021-05-22
    121 min

    390JAC-091 [Saddle Tide Limit Breakthrough x Creampie Facial Cumshot 12 Barrage] Tide! tide! tide! tide! Saddle tide sprinkling libido! It’s still not enough to fire 3P12! Ultimate sex beast presented by Jackson! The ultimate weapon! Do you have

  • amateur censoredcreampiesquirtingjacjac-091jac091390jac-091
    • 2021-05-22
    44 min

    FC2PPV 1831192 147cm E Cup ♥ Chibi Big Breasts Chika (19 years old JD) "It was warm ♥" I was fascinated by the first sperm bukkake in my life … Suddenly in the bath! In the washroom! !! [4th]

  • amateur uncensoredfc2
    • 2021-05-24
    80 min

    259LUXU-1412 Luxury TV 1408 Mrs. President who appeared in AV with a beautiful body called a former race queen! The reason is that I was begged by my husband who likes NTR! ？？ Contrary to the interview where he was at a loss, in the actual production

  • amateur censoredbig titsmarried womanluxuluxu-1412luxu1412259luxu-1412
    • 2021-05-28
    41 min

    [HEYZO-2541]Darcia Creampie in Europe ＃Darcia3

  • darcia uncensoredheyzo
    • 2021-06-04
    118 min

    [ATID-463]I Spent 48 Hours Continuously Fucking 2 S*****ts, Until Their Bodies Had Evolved To The Point That They Couldn't Live Without Me. Ichika Matsumoto Mai Kagari

  • ichika matsumoto flower hunting censoreduniformbeautiful girlATIDattackersdragon nishikawain madATID-463ATID463atid00463
    • 2021-06-10
    44 min

    H0930 ki210610 Eriko Sawaki 32years old

  • amateur uncensoredh0930
    • 2021-06-15
    125 min

    [STARS-385]Younger Sister Seduces Her Older Sister's Husband With Hot And Steamy Tongue Kissing Three Day Holiday Spent At Home Kissing And Having Sweaty Sex Kaede Hiiragi

  • hiiragi kaede censoredbeautiful girlslutSTARSsod createdragon nishikawasod starSTARS-385STARS3851stars00385
    • 2021-06-26
    64 min

    H0930 ki210627 Takai Junko 37years old

  • amateur uncensoredh0930
    • 2021-07-08
    119 min

    [SPRD-1435]Best Aunt Rieko Hiraoka

  • rieko hiraoka censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1435SPRD143518sprd01435
    • 2021-07-09
    77 min

    FC2PPV 1913586 "Please erase what you took …" Unauthorized sale of 19-year-old active idol eggs and slender beautiful girls who look good in red clothes. Massive ejaculation on the face of a pure girl chasing her dream.

  • amateur uncensoredfc2
    • 2021-08-16
    152 min

    FC2PPV 2035326 Free Announcer Outflow * Limited Quantity *

  • amateur uncensoredfc2
    • 2021-08-18
    150 min

    Caribbeancom 081821-001 Bloomers Anthology Tsubasa Miyashita, Shizuku Hatano, Mirei Yokoyama, Airi Mizusawa, Sanae Akino, Kaede Aoshima

  • amateur uncensoredcreampielesbiancaribbeancom
    • 2021-08-21
    240 min

    [GIGL-656]From-Above Footage: Cheeky Married Woman Coming From The Piston Action Of A Weakling

  • censoredblowjobGIGLgigolo jigorogigoloGIGL-656GIGL656gigl00656
    • 2021-09-10
    68 min

    FC2PPV 2186488 A Beautiful Slender Who Works At A Bank Counter For The Second Year As A Member Of Society. A Large Amount Of Joy Juice Spills After Tearing Her Black Stockings. She Has A Large Amount Of Squirting, A Shameful Expression, And A Large A

  • amateur uncensoredfc2
    • 2021-09-17
    124 min

    [FOCS-021]Innocent 143cm Beautiful Girl From Abroad. "I"ve Made It To Japan" She Awakens To New Sexual Pleasures After Getting Used By Crazed Horny Men. Konomi Kimino

  • konomi kimino censoredsingle workFOCSabc mousou zokufocusFOCS-021FOCS021focs00021
    • 2021-09-18
    71 min

    533NNS-006 Lori Beauty Shaved Pussy Creampie Sperm Outflow Video! !! Continuous Nn Piston To The Squirting Pussy That Died Jerky With Toy Masturbation With An Inviting Horny Butt! !!

  • amateur censoredcreampieamateurnnsnns-006nns006533nns-006
    • 2021-10-08
    118 min

    [SSIS-203]Rara Anzai. Her Powers of Reason Fly Out the Window. Celibacy x Addiction to Aphrodisiacs. Abnormally Strong Climaxes

  • anzai rara censoredbig titssingle workSSISs1 no 1 stylemonSSIS-203SSIS203ssis00203
    • 2021-10-21
    198 min

    [NHDTB-591]2 Holes Creampie Group Sex Bus 3

  • censoredcreampiesquirtingNHDTBnatural highjaken kodamaNHDTB-591NHDTB5911nhdtb00591
    • 2021-11-12
    118 min

    [MEYD-717]My Father Remarried And At The Sight Of My Mother-in-law"s Ass With No Pants, I Couldn"t Bear It And Cream-Pied Her From Behind. Misaki Sakura

  • cape sakura censoredcreampiesingle workMEYDtameike goroMEYD-717MEYD717meyd00717
    • 2021-11-19
    120 min

    [HMN-079]What!？ A Secret Creampie In A Place Like This!？ When A Popular AV Actress Asks Her FWB To Film Their Creampie Sex... Complicating My Private Life, We Secretly Film An AV So My Friends Won"t Find Out. Nanami Kawakami

  • kawakami nanami censoredcreampieblowjobHMNhonnakamamezawa mametarouHMN-079HMN079hmn00079
    • 2021-12-17
    124 min

    [PPPD-989]Riho Fujimori, Spence Breast Development Clinic

  • riho fujimori censoredcreampiebig titsPPPDoppaiPPPD-989PPPD989pppd00989



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored