blowjo javcensored high visio creampie censored




FC2DASDROYDHODVMIDVADNCAWDNACRPREDFSDSSSHKDJULGVHDASDNACXSQTEAMBIKSBJHMNEBODMARA

2020-12-05
63 min

[HHKL-075]An Excessively Big Tits Stepmom Is Strangely Kind And Gentle To Her Stepson, But That's Because She's Got Ulterior Motives. Is This Stepmom Transforming Into A Perverted Horny Bitch？ Her Stepson Was Shy, But She Got Him To Take A Ba

  • takarada monami censoredcreampiebig titsHHKLhuntervolvo nakanohhh groupHHKL-075HHKL075hhkl00075
    • 2020-12-06
    146 min

    [GENT-156]What, Really!？ My Favorite Gravure Idol Shows Up For Porn Shoot Interview! After Brainwashing Her Into Becoming A Cum Receptacle It Turns Out She's Actually A Massive Slut So I Fucked Her And Gave Her A Crazy Creampie!

  • censoredcreampiebig titsGENTgentle man mousouzokugentleman mousouzokuGENT-156GENT156gent00156
    • 2020-12-16
    18 min

    FC2PPV 1608304 [No] I called a blonde beauty who wanted it and made a vaginal cum shot

  • amateur uncensoredfc2
    • 2020-12-21
    121 min

    [BLOR-159]Voluptuous Hotel Clerk - This Polished Professional Will Make Your Body Melt And Make Your Dick Weep - Politely, Of Course!

  • censoredcosplayBLORbroccoli mousouzokubroccolibroccoliBLOR-159BLOR159blor00159
    • 2020-12-27
    50 min

    Pacopacomama 122720_404 Natsumi Hirose

  • natsumi hirose uncensoredcreampieblowjobpacopacomama
    • 2020-12-30
    87 min

    348NTR-026 Depression Bokki confirmed times! !! !! I’ve taken a beautiful girl with a weak intention, Miyuki Susuki, to sleep! !! !! Immorality and excitement are inevitable in the appearance of feeling big and big with a crying face! After the

  • amateur censoredamateurntrntr-026ntr026348ntr-026
    • 2021-01-02
    64 min

    FC2PPV 1628754 [Industry Revolution] The second famous YouTuber collaboration project! All-you-can-eat YouTuber emergency participation, vaginal cum shot orgy, fucking * Complete appearance / Completely original with a large amount of seeding even th

  • amateur uncensoredfc2
    • 2021-01-08
    146 min

    [NHDTB-482]Slipping Into Your Yukata Even If The Other Customers Are Watching - Little Slut At The Hot Spring Wants To Ride Your Dick For A Creampie

  • censoredcreampieslutNHDTBnatural highbacon tanakaNHDTB-482NHDTB4821nhdtb00482
    • 2021-01-15
    206 min

    [PYM-362]Self Shot Bukkake, Facial, Lotion, And Explosive Orgasms! Buck Naked Masturbation

  • censoredPYMprimoPYM-362PYM362h-283pym00362
    • 2021-01-25
    66 min

    [SHH-018]Tiny-Titted Slut Cries Out For Cock... And Teases It Until You Cum!

  • censoredbeautiful girlslutSHHnatural highSHH-018SHH0181shh00018
    • 2021-02-11
    115 min

    [FSDSS-172]Impatiently Begging: Super Horny Sex - Moe Tenshi

  • angel moe censoredblowjobsingle workFSDSSfalenoyamaguchi memberfaleno starFSDSS-172FSDSS1721fsdss00172
    • 2021-02-12
    124 min

    [EBOD-799]The World's Most Erotic Woman Is A Man-eating Slut Ad Libbing Everything

  • censoredcreampieslutEBODe bodymichiru arashiyamaEBOD-799EBOD799ebod00799
    • 2021-02-18

    FC2PPV 1691556 Limited time [Uncensored] Night date with sensitive apparel clerk, continuous vaginal cum shot (64 minutes)

  • amateur uncensoredfc2
    • 2021-02-25
    106 min

    [SPRD-1382]I Creampied My Boss's Mom - Yurie Miyata

  • yurie miyata censoredmature womanmomSPRDtakara eizokyuta tukumoaleddinSPRD-1382SPRD138218sprd01382
    • 2021-03-12
    109 min

    483SGK-017 [Different Dimension I Eye Cup] [Spring Pie Festival] [Big Breasts Instructor Beyond Big Breasts] [4 Barrage Raw Saddle] [Continuous Pursuit Creampie] [Libido Explosion Iki Madness] ABCDEFGH … I Cup! !! Phantom eyecup! I think I can&#

  • amateur censoredsquirtingamateursgksgk-017sgk017483sgk-017
    • 2021-03-13
    202 min

    [MIRD-211]Tempting Panty Shot Beautiful Girl Harlem Sex 3 I'm Surrounded By Sluts In Heat And They're Making Me Cum Until My Dick Breaks Down Mitsuha Higuchi Rin Kira Aoi Mukai

  • mitsuha higuchi kira rin censoredbeautiful girlslutMIRDmoodyzdragon nishikawamoodyz realMIRD-211MIRD211mird00211
    • 2021-03-28
    58 min

    [490FAND2-1]れん 1

  • amateur censoredbig titsamateurfand2fand2-1fand21490fand2-1
    • 2021-04-01
    36 min

    FC2PPV 1750481 [Personal shooting] ♀206 Female college student Me ◯ -chan 19 years old 7th time Pregnancy AV shooting training started for the second time without being disappointed in the fall ◯! (LOL)

  • amateur uncensoredfc2
    • 2021-04-08
    126 min

    [IENF-134]Amateur College Girl Babes Only! Would You Like To Experience Some Hard And Tight Coed Bathing In A Cramped Bathtub!？ See Her Body Burn With Lust! See Those Nip Slips! Enjoy Watching An Innocent Girl Blush With Excessively Bashful Teary Eye

  • hina hotaka karen anba censoredcreampieschoolgirlIENFienergytiger kosakaiienfIENF-134IENF1341ienf00134
    • 2021-04-14
    120 min

    [GVH-218]Naughty Nurses Ka Ayano Fuji

  • ayano kato censoredcreampiegrandfatherGVHglory questhyonGVH-218GVH21813gvh00218
    • 2021-04-19
    115 min

    [083PPP-2120]深夜営業の女性限定マッサージ店を完全盗●(15)～オイルまみれで揉みしだかれる女たち

  • amateur censoredamateurpppppp-2120ppp2120083ppp-2120
    • 2021-04-20
    86 min

    [DMAT-192]While This Stepmom Rests Her Stepson Paid Her A Night Visit

  • censoredcreampielingerieDMATstar paradisedamatenDMAT-192DMAT192h-254dmat00192
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    160 min

    [DVDMS-660]I Couldn't Handle How Hot She Was In Her Pant Suits So I Started Grinding Up Behind Her And She Agreed To A Quickie! 3 - Office Girls Are Giving Private Viewings To Male Clients Who Get Grabby! But The Hard Cocks They Feel Are Way Bigg

  • censoredamateurDVDMSdeepsnagases wingdeep sDVDMS-660DVDMS660dvdms00660
    • 2021-05-02
    88 min

    345SIMM-640 Dirty Big Tits Glasses J ○ And Hot Affair! I was groped with H milk and spilled holy water from my mouth! Self-milk licking is also good! !! The sexual power of 530,000 Kansuto Hentai-chan, whose fighting ability is too cute, is here! !!

  • amateur censoredcreampiebig titssimmsimm-640simm640345simm-640
    • 2021-05-08
    151 min

    [MDBK-176][Its A Miracle!] When I Called For A Delivery Health Girl I Got My Local Big Tits Friend And I Had A Great Time!! 6

  • inaba honoka wakamiya censoredcreampiebig titsMDBKbazookaMDBK-176MDBK176mdbk00176
    • 2021-05-19
    37 min

    FC2PPV 1826072 [No] [Limited to 100 pieces 2980 → OFF to 1480pt!] The long-awaited sequel to a beautiful beauty who is too beautiful ♥ ️ I’m doing something more erotic than the previous work! * Review benefits / Shivering ♥ Denma masturbation ♥

  • amateur uncensoredfc2
    • 2021-05-20
    125 min

    [IENF-144]You Can Clearly See Th Shape Of Their Clits! Sexy Masturbation Over Panties With Repeated Orgasms 3

  • ena koume yu tomita censoredbig titsIENFienergyienfIENF-144IENF1441ienf00144
    • 2021-07-06
    209 min

    [SDMM-095]The Magic Mirror Number Bus Young Mothers With Big Tits, Pushing Baby Carriages, Only! We Called It The "Boob Rubbin Examination" And We Relentlessly Rubbed These Titties (3 Times As Sensitive After Giving Birth) As We Pleased! When

  • censoredcreampiebig titsSDMMsod createakira saijomagic mirrorSDMM-095SDMM0951sdmm00095
    • 2021-07-17
    119 min

    [JUL-656]Exclusive: Minori Hatsune is Driven to Ecstasy before an Intense Vaginal Creampie!! Secretive Cheating Sex with a Hot Wife and Her Real Estate Agent.

  • hatsune minori censoredbig titsmature womanJULmadonnarokusaburo mishimaJUL-656JUL656jul00656
    • 2021-07-24
    62 min

    [DANDAN-007]"I'm An Old Lady, But I Can't Control Myself Anymore ..." I Was At A Men's Massage Parlor That Didn't Allow Any Nookie, But This Sexy Therapist Kept On Luring Me To An Erectile State, So She Offered Me Several Con

  • censoredbig titshandjobDANDANdandytanaka baconDANDAN-007DANDAN0071dandan00007
    • 2021-08-21
    129 min

    [MKON-060]My Girlfriend Used To Be A Clean Freak. Now She"s Getting Constantly Creampied By A Middle Aged Man In A Smelly Room Filled With Garbage, Starring Rei Kuruki

  • satoshi kuruki censoredcreampieuniformMKONkaguya hime pt mousozokuyumesaki ichiroumikonMKON-060MKON060mkon00060
    • 2021-08-27
    50 min

    HEYZO 2618 Sex With Old Men After 3 Yrs’ Absence – Misaki

  • misaki uncensoredheyzo
    • 2021-09-02
    243 min

    [CVDX-462]Skinny Body But Soft And Firm Boobs! 30 Women, 4 Hours

  • censoredcreampiemature womanCVDXcenter villageCVDX-462CVDX462h-086cvdx00462
    • 2021-09-03
    188 min

    [WAAA-091]You Live, If You Can Endure Minami Hatsukawa"s Awesome Technique - Creampie SEX!

  • hatsukawa minami censoredcreampieblowjobWAAAwanz factoryWAAA-091WAAA091waaa00091
    • 2021-09-09
    60 min

    SIRO-4623 [First Shot] [Small Devil Cowgirl] [Blow Job] An Innocent New Esthetician Who Laughs Cheerfully. A Carnivorous Girl Who Seems To Be Pure, Flirts With Her Cock While Rushing And Shakes Her Hips As If Tossing A Man .. Application Amateur, Fir

  • amateur censoredamateursirosiro-4623siro4623siro-4623
    • 2021-09-09
    57 min

    H4610 ki210909 Fuyumi Noguchi 18years old

  • amateur uncensoredh4610
    • 2021-09-11
    350 min

    [SCPX-432]No...Father-In-Law!! Please, Stop...These Wives Get Their Father-In-Law"s Massive Cocks Inserted Into Them While S******g Next To Their Husbands And Have An Amazing Climax 2 Discs 350 Minutes 8 Girls

  • censoredcreampieblowjobSCPXk m producehasshiscoop kmpSCPX-432SCPX432scpx00432
    • 2021-09-25
    65 min

    FC2PPV 2249561 * None * Appearance Sakura-Chan Private Sex Final Chapter! After Having A Date And Laughing A Lot, I Made A Series Of Vaginal Cum Shots.

  • amateur uncensoredfc2
    • 2021-10-14
    63 min

    299EWDX-382 Sura Milk H Cup! Convulsions Acme Barrage With Raw Ji ○ Port After A Long Absence!

  • amateur censoredcreampiebig titsewdxewdx-382ewdx382299ewdx-382
    • 2021-10-18
    72 min

    530DG-017 ＃ 1 Female ○ Student By Convenience Store Manager ●●●● Video

  • amateur censoredcreampiebig titsdgdg-017dg017530dg-017
    • 2021-10-23
    239 min

    [MCSR-458]Must Do It Once Before I Die!! Erotic MILF Who Will Commit Adultery To Get a Creampie 4 Hours!! Maki Hojo , Shinobu Igarashi , Yuri Honma ...Other Masturbation Addiction Alert!! Erotic Sex of 10 Married Women!

  • hojo asahi shinobu igarashi censoredmature womanMCSRbigmorkalmasukaku takeshimasukattoMCSR-458MCSR45857mcsr00458
    • 2021-11-20
    143 min

    [DBER-132]BeAST: The Crazy And Humiliating Narcotics Investigator Case-007: The Case Of Erina Kurahashi The Cruel Time Until The Woman Who Is Superior To Men Falls Cruelly Shiina Hirai

  • shiori hirai censoredbdsmsingle workDBERbabyentertainmentkikubonred babeDBER-132DBER132dber00132
    • 2021-12-10
    139 min

    [YMDS-066]Cuddling and D***king at Home, French Kissing and Having Sex Closely, The Day Yu Hironaka Became my Girlfriend

  • yu hironaka censoredcreampieblowjobYMDSmomotarou eizou shuppanjaku momoYMDS-066YMDS066ymds00066
    • 2021-12-17
    180 min

    [EBOD-878]A New Girl With A J-cup Who Is Too Kind To Come To Tokyo From The Countryside. Full Course Of Sex Life Riko Onozaki

  • riko onozaki censoredcreampiebig titsEBODe bodytrendy yamaguchiEBOD-878EBOD878ebod00878
    • 2022-01-08
    60 min

    10musume 010822_01 The Finest Body That Is Obscene To The Bondage Rena Hashimoto

  • amateur uncensored10musume
    • 2022-01-22
    240 min

    [HUSR-246]Class Reunion - I Met My Classmate First Love Again For The First Time In 30 Years

  • censoredmarried womanmature womanHUSRbig mocalbooker thustleHUSR-246HUSR24657husr00246
    • 2022-01-22
    81 min

    FC2PPV 2611091 A Hotel Date To Make Up With Mei-Chan, An Active Second Grader, In April. Enjoy The Growing Immature Slender Body Again. A Large Amount Of Vaginal Cum Shot Is Made To A Body That Is Too Beautiful To Become An Adult.

  • amateur uncensoredfc2
    • 2022-01-29
    121 min

    [BKD-277]Stepmother And Offspring Sex. [West Otawara Road] Nanao Nakano.

  • nanao nakano censoredcreampiemature womanBKDrubytsuji koujitabijiBKD-277BKD277bkd00277
    • 2022-02-05
    132 min

    [URKK-054]Minimum Of 10 Shots! Huge Tit Aphrodisiac Salon With Unlimited Cream Pies As They Shake Tits. Alice Kisaki

  • kisaki alice censoredcreampiebig titsURKKunfinishedwild sevena familiar breastURKK-054URKK054urkk00054
    • 2022-02-18
    182 min

    [SSIS-334]Saika Kawakita Services You At A Five-Star Top-Class Soapland.

  • ayaka hebei censoredblowjobsingle workSSISs1 no 1 stylemon cSSIS-334SSIS334ssis00334
    • 2022-03-05
    233 min

    [MLMM-001]Beautiful Mature Women Best: Ayako Inoue, 4 Hours, A Madonna With Beautiful Ass And Legs

  • ayako inoue censoredcreampiesingle workMLMMmellow moonMLMM-001MLMM001mlmm00001
    • 2022-03-17
    56 min

    C0930 ki220317 Syoko Tsuge 25years old

  • amateur uncensoredc0930
    • 2022-03-17
    52 min

    491TKWA-213 I Put It Out In This Girl 10 Minami Momo

  • amateur censoredcreampiebig titstkwatkwa-213tkwa213491tkwa-213
    • 2022-03-25
    74 min

    534IND-030 The Second Round & Leaked Scene With A Busty Beauty Similar To An Innocent Actress Leaked

  • amateur censoredcreampieamateurindind-030ind030534ind-030
    • 2022-03-25
    118 min

    T28-613 初潮が来たあの日から…愛娘を犯し続ける父親近親相姦映像

  • censoredT28tmaT28-613T2861355t2800613



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored