blowjob high vision jav nampa




FC2SSISDASDHDKASTARSSDABNACRFSDSSKBIPREDCHRVSQTESPRDMIDVMIDEADNMARAMVSDMEYDHUNTBHODV

2020-10-20
136 min

[KMHRS-030]I Want My Favorite Ugly Lover To Fuck Me Long And Dirty! Kanon Amane

  • natural kanon censoredamateursingle workKMHRSsod createinoue japankimihoreKMHRS-030KMHRS0301kmhrs00030
    • 2020-10-22
    93 min

    [OKS-098]Wet And Shiny, Perfectly Fitting Godlike Swim Suit: Horikita Tsumugi. Enjoy These Cute S*********ls' Swimsuits! This AV Starts With A Voyeur View Into A Changing Rom, And Ends With Close-ups Of Fetishes Such as Shaved Pussies, Hair Stick

  • horikita tsumugi censoredbeautiful girlsingle workOKSdaddy s private photosgoddess in a school swimsuitOKS-098OKS0981oks00098
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-11-06
    115 min

    [PARATHD-3043]Would You Light Up Mao Hamasaki 's Pussy With A Vibrator？ A Sightseeing Tour Of Tokyo And She's Horny The Whole Time

  • hamazaki mao censoredsingle workPARATHDparadise tvPARATHD-3043PARATHD3043parathd03043
    • 2020-11-09
    16 min

    10musume 110920_01 Secret Pussy Collection: Hana Hoshino

  • amateur uncensored10musume
    • 2020-11-26
    124 min

    [MILK-096]120 Minutes Of Totally Uncut Sex It's Time To Overcome The Temptation Of The Cock Squad The Nonstop Masturbation Challenge Riona Minami

  • rina minami censoredsquirtingbeautiful girlMILKmilkMILK-096MILK096h-1240milk00096
    • 2020-12-05
    148 min

    [BBAN-304]Two-Hole S&M Lesbian Training - Hard Girl-On-Girl Fetish Fucks

  • mihina azumihina mihina nagai naoki kiritani censoredlesbianBBANbibianBBAN-304BBAN304bban00304
    • 2020-12-07
    42 min

    [gerk-332]さらお姉ちゃん

  • amateur censoredcreampieamateurgerkgerk-332gerk332gerk-332
    • 2020-12-18
    35 min

    [BTH-098]My Evil Wife Is Cold Towards Me, But In That World, It Seems That She's A Highly Rated Bitch Who's Good For Breaking In. Miwako Yamamoto

  • yamamoto miwako censoredblowjobsingle workBTHchobitchsuper bitchBTH-098BTH098h-1435bth00098
    • 2020-12-26
    190 min

    [JKSR-473]Will You Have A D***k With Me Ma'am？ We Tried Getting A Married Woman To Swallow Liquor - And Cum. @ Shinjuku - Rural Wives Only - Picking Up Married Girls At A Bus Stop With Reasons To Cheat 7

  • censoredamateurJKSRbig morkalobockeyprink junkyJKSR-473JKSR47357jksr00473
    • 2021-01-04
    102 min

    300MIUM-659 Explosive huge breasts I cup married woman! !! Big breasts mountain range that appeared in Shinagawa! You can massage it! You can smoke! You can pinch it! An erection is inevitable due to the overwhelming softness! [Frustration that incre

  • amateur censoredcreampiebig titsmiummium-659mium659300mium-659
    • 2021-01-13
    47 min

    302GERK-339 A-san

  • amateur censoredcreampiebig titsgerkgerk-339gerk339gerk-339
    • 2021-01-27
    241 min

    [FSPT-008]They are loose, but calm you down. Countryside Girl Collection

  • censoredbig titssquirtingFSPTfirst starpeachteenFSPT-008FSPT008h-491fspt00008
    • 2021-02-07
    74 min

    300NTK-515 Matching with the model-class style G-cup high-flying beauty! !! The tide that blows from high altitude from tall maco! !! I’m going to take a profile picture of Miss Kyaba … Gutsuri raw chin ascension record started! !! SEX-indu

  • amateur censoredcreampiebig titsntkntk-515ntk515300ntk-515
    • 2021-02-12
    79 min

    [ZOZO-037]姫野かんな先生

  • censoredZOZOsadie willenauZOZO-037ZOZO0371zozo00037
    • 2021-02-20
    95 min

    [ISD-002]You Only Call Me When You're Lonely, But I Want You So Badly It Drives Me Crazy Yuri Fukada

  • censoredISDdream ticketnishiki sasaISD-002ISD002h-254isd00002
    • 2021-03-01
    303 min

    [DOKS-538]For Discerning Pantyhose Fanciers - Magazine Models With Beautiful Legs' Masturbation In Glistening Pantyhose BEST Collection 5 Hours

  • yumi konomi nao tachibana nauri uehara censoredslutDOKSoffice k sseichu matsumotoDOKS-538DOKS53836doks00538
    • 2021-03-07
    54 min

    FC2PPV 1679101 Yuko, an active cosmetologist who has an adult sex appeal ❤️ We are looking for someone who will change into naughty underwear and defeat the sexual desire monster that tempts you together.

  • amateur uncensoredfc2
    • 2021-03-22
    132 min

    [GENM-076]Driving Date With A Perverted Guy - Rika Tsubaki

  • tsubaki rika censoredbig titssingle workGENMgenekig 3GENM-076GENM076genm00076
    • 2021-04-03
    120 min

    [ANB-186]I Became My Mom's Sex Toy Instincts Revealed Lusty Hot Mother-in-law! Nanako Takamiya

  • nanako takamiya censoredmature womanslutANBrubysusumu yanokuchinobleANB-186ANB186anb00186
    • 2021-04-08
    93 min

    [OKB-109]A Voluptuous Big Ass A Goddess In Bloomers Shion Natsume From A Lolita Beautiful Girl, To A Chubby Girl, We Dressed These Hot Bitches In Tight Bloomers And Gym Shorts So We Could See Their Asses And Cameltoes Bulging Out So Hard Their Pussy

  • shion natsume censoredschoolgirlsingle workOKBdaddy s private photosgoddess in bloomersOKB-109OKB1091okb00109
    • 2021-04-18
    27 min

    FC2PPV 1776135 [4K] [Individual shooting] Suzu-chan 20 years old part19 4K version part 4

  • amateur uncensoredfc2
    • 2021-04-24
    56 min

    Pacopacomama 042421_464 The Lady Comes From the Brothel Brings Her Special Kinky Shower Stool! Natsuki Kikuta

  • amateur uncensoredpacopacomama
    • 2021-05-01
    64 min

    324SRTD-0224 I Can’t Stand It Should Be Just An AV Interview And Insert A Runaway Student!

  • amateur censoredbig titsamateursrtdsrtd-0224srtd0224324srtd-0224
    • 2021-05-02
    60 min

    FC2PPV 1799085 Nogizaka4 ○ "Mai Shiraishi ◯" super beautiful receptionist advent! !! G cup, outstanding style, deep throat, guillotine, gag, vaginal cum shot seeding, "personal shooting" individual shooting original 129 people

  • amateur uncensoredfc2
    • 2021-05-08
    45 min

    C0930 ki210509 Hinako Todaka 30years old

  • amateur uncensoredc0930
    • 2021-05-15
    233 min

    [BANS-001]Nihao Saiko 1

  • censoredschoolgirlBANSnihao the best daydream tribeBANS-001BANS001bans00001
    • 2021-05-16

    FC2PPV 1821193 Up to 20 [Individual] Frightened by my father by the window. It makes her suck mercilessly and pollutes her parents’ house. A wife who drips sperm that has been pushed out of the uterus at the hotel on the way home.

  • amateur uncensoredfc2
    • 2021-05-20
    20 min

    HEYZO 2529 Yu’s Orgasms with Toys – Yu Sakuma

  • yu sakuma uncensoredblowjobheyzo
    • 2021-05-21
    116 min

    [MISM-201]Three Days Face Fucking My Slutty Deep Throating Step Niece Until I'm All Out Of Cum Ichika Kasagi

  • kasagi ichika censoredbeautiful girlslutMISMm girls labtetsuya taniwatashiMISM-201MISM201mism00201
    • 2021-06-01
    59 min

    1Pondo 060121_001 Seducing by Flashing Pussy: Nagisa Shinohara

  • amateur uncensored1pondo
    • 2021-06-04
    115 min

    [JUL-600]The Tragedy That Befell The Married Woman Living On The Bottom Floor Humiliating G*******g According To The Apartment Building Caste System Rima Suzukawa

  • rima suzukawa censoredmature womansingle workJULmadonnahiroyuki kimuraJUL-600JUL600jul00600
    • 2021-06-16
    120 min

    [FOCS-001]Super Sexy Poor Girl Who Lives At An Internet Cafe Even Though She's Hungry All She Wants To Do Is Keep Cumming Does She Love Men More Than Food？!

  • censoredblowjobbeautiful girlFOCSabc mousouzokufocusFOCS-001FOCS001focs00001
    • 2021-06-25
    120 min

    [WAAA-080]Eating Out The Best Mistress And The Best Slut Raw In This Sexual Affair - Ai Sayama

  • sayama love censoredcreampiebig titsWAAAwanz factorywanzWAAA-080WAAA080waaa00080
    • 2021-07-03
    140 min

    [PKPD-151]Entertainment Escort

  • scooping hanai shizuku censoredcreampiesquirtingPKPDfuck group and fun friends daydreamersPKPD-151PKPD151pkpd00151
    • 2021-07-07
    70 min

    ION-090 Kotone

  • amateur censoredsquirtingamateurionion-090ion090ion-090
    • 2021-07-24
    58 min

    Caribbeancom 072421-001 I did 3P because I found out my wife had sex with her housewife friend of the housing complex Yui Kawagoe, Manami Ueno

  • amateur uncensoredcreampielesbiancaribbeancom
    • 2021-07-29
    84 min

    FC2PPV 1946094 [Virgin Immediate Scale] Immediately After Meeting Ace, If You Can Endure The Immediate Scale For 5 Minutes, Vaginal Cum Shot Is Ok * Complete Appearance, Cum Swallowing, Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-08-21
    49 min

    H4610 ori1763 Kaori Kokado 21years old

  • amateur uncensoredh4610
    • 2021-09-01
    120 min

    [NACR-453]The Runaway And Me Kasumi Ikeya

  • kazumi ikeya censoredblowjobmature womanNACRplanet plussakura ninshichi ku ryuuNACR-453NACR453h-237nacr00453
    • 2021-09-11
    119 min

    [LUNS-080]60 Something Doggy Style 11

  • censoredcreampiemature womanLUNSluna shunkoushaLUNS-080LUNS080luns00080
    • 2021-09-13
    72 min

    107OKYH-081 Completely Taken! G-Cup Amateur Challenges "To Have A Male Customer Lick The Whole Body Of Hot Water Drops"! Misuzu-San Estimated G-Cup Towel Why Don’t You Take A Men’s Bath？

  • amateur censoredamateurokyhokyh-081okyh081107okyh-081
    • 2021-09-17
    124 min

    [TPPN-205]Rurucha"s TEPPAN Premier! A Cum Soaked Daze With Plenty Of Squirting And Love Juice! Nonstop Group BUKKAKE

  • rurucha censoredsquirtingsingle workTPPNteppanTPPN-205TPPN205tppn00205
    • 2021-09-25
    59 min

    521MGFX-022 Excavation ☆ Big Breasts Amateur 19

  • amateur censoredbig titsmarried womanmgfxmgfx-022mgfx022521mgfx-022
    • 2021-09-29
    48 min

    FC2PPV 2268762 Limited [Uncensored] 147 Cm Small Animal F Cup Girl For The First Time Continuous Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-10-12
    57 min

    Pacopacomama 101221_544 Even If She Got Older, She’s Still Driven Men Crazy

  • amateur uncensoredpacopacomama
    • 2021-10-15
    150 min

    [BLK-532]She"ll Eat Men Up As She Bares Her Super Carnivorous Sexual Instinct To Prey On Cocks! Let"s Cum With Queen Maria! An Orgasmic Banging Date Maria Nagai

  • maria nagai censoredcreampiebig titsBLKkira kiratorendei yamaguchikira hosi kira black galBLK-532BLK532blk00532
    • 2021-10-22
    180 min

    [SSIS-217]*A Maso Beautiful Girl The Blossoming Of A Slut A Horny Dirty Talk Men"s Massage Parlor Where You"ll Get Ejaculated So Much You"ll Never Enjoy Masturbation Ever Again Izuna Maki

  • izuna maki censoredsluthandjobSSISs1 no 1 stylemasaki naoSSIS-217SSIS217ssis00217
    • 2021-10-28
    488 min

    [MGHT-298]Stepmom Is Even Hotter Than My Wife... The Ultimate Best Of Collection, 8 Hours, 2 Volumes.

  • censoredmarried womanmature womanMGHTtakara videotakaraMGHT-298MGHT29818mght00298
    • 2021-11-05
    119 min

    [HZGD-203]The Cherry Boy Next Door Finally Has A Girlfriend So As A Kind Married Woman I Let Him Practice Sex and Creampies. Ichika Matsumoto

  • ichika matsumoto censoredcreampiesingle workHZGDhitodzuma hanazono gekijouoosaki hirokoujiHZGD-203HZGD203h-1100hzgd00203
    • 2021-11-05
    123 min

    [IPX-763]A Body That Is Sensitive... Nanami Misaki, A Sweaty Yoga Instructor Wife Who Has Been Fucked By Her Father-in-law And Continues To Be Fucked.

  • nanami misaki censoredcreampiesingle workIPXidea pocketdoragon nishikawatissueIPX-763IPX763ipx00763
    • 2021-11-05
    184 min

    [HUNTB-139]A Dream Threesome! Step-sister Went Out Partying With Her Female Friend And Missed The Last Train Home, Now They"re At My Apartment Laying In Bed With Me! The Toss And Turn In Bed, Revealing Their Panties And Breasts...

  • censoredcreampieblowjobHUNTBhunterkoichi davidsonhhh groupHUNTB-139HUNTB139huntb00139
    • 2021-11-19
    240 min

    [REXD-387]Small Town Workshop Afterparty - Exhausted Female Employees Get Stripped Down To Their Sweaty Skin...

  • censoredcreampieuniformREXDredgroupREXD-387REXD387rexd00387
    • 2021-11-27
    61 min

    [112721-001]Threesome heaven: two seductive women who have big boobs

  • amateur uncensoredcreampiecaribbeancom
    • 2021-12-31
    118 min

    [NNPJ-490]I Want To Fuck A Girl From Minato Ward I Went To A Stylishly Moody Bar And Had Some Cool Evening Champagne To Start Things Off Right, And Then i Took This Slender Beauty Who Looked Good Enough To Be A Model To A High-Class Hotel For Some Co

  • censoredcreampiebeautiful girlNNPJnanpa japanNNPJ-490NNPJ490nnpj00490
    • 2022-01-01
    122 min

    [XVSR-629]Perfect Rearing. Stocking. Confinement. 24 Hours. Ichika Mogami

  • ichibana mogami hana sato censoredsingle workXVSRmax ak c takedacalenXVSR-629XVSR629xvsr00629



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored