busty fetish big tit jav delusion grou javcensored




FC2NACRFSDSSSSNIHODVROYDSTARSMVSDCHRVNATRADNCAWDHDKAEBODMEYDDTTSDABABWIPXAMBIPPPD

2020-11-29
113 min

[RPIN-045]A Cut And Dried Part-Time Worker At A Ramen Noodle Shop She Answered Our Ad With No Illusions, But When She Got Pumped Full Of Rock Hard Cocks, She Came Like A Bitch

  • censoredamateurRPINlycopene mousouzokukakeru ozoraRPIN-045RPIN045rpin00045
    • 2020-12-01
    61 min

    HEYZO 2406 After 6 -I Can’t Hold Back Sexual Urge- – Yui Minami

  • yui minami uncensoredcreampieheyzo
    • 2020-12-12
    166 min

    [FFFS-023]Picking Up MILFs! Horny Mature Sluts Caught On Camera 20 - Tall Girls! Colossal Tits! Two Wild Nympho Wives Edition - Prim, Pretty 40-Year-Old Nagisa, I-Cup, 5ƌ" - Curvy 38-Year-Old Saki, L-Cup, 5Ǝ", Takes A Creampie

  • censoredcreampieslutFFFSmature woman private videos emmanuellemanji groupFFFS-023FFFS023fffs00023
    • 2020-12-17
    61 min

    Caribbeancom 121720-001 The Story Of Luxury Spa Lady, Vol.86 Miki Aimoto

  • miki aimoto uncensoredcreampiehandjobcaribbeancom
    • 2020-12-20
    117 min

    [NNPJ-421](Aphrodisiac x Sex With Chems x Amateur Girls 01) She Came To The Capital To Get Picked Up - This Prim, Pretty Bad Girl Is Slipped Something That Turns Her Into A Raging Nympho! Screaming Orgasms, Incredible O-Faces, And Creampie Fucks!

  • censoredcreampiebeautiful girlNNPJnanpa japanNNPJ-421NNPJ421nnpj00421
    • 2020-12-24
    487 min

    [ABBA-501]Reiko Sawamura - Precious Best - 36 Scenes, 20 Creampies, 31 Loads, 10 Films, 8 Hours, 2 Discs

  • reiko sawamura honami takasaka masumi takasaka censoredcreampiemature womanABBAcenter villageABBA-501ABBA501h-086abba00501
    • 2020-12-29
    87 min

    FC2PPV 1624838 Reina challenges SM training sex for the first time ❤️❤️ Saliva, love juice and serious juice dripping … [Personal shooting]

  • amateur uncensoredfc2
    • 2021-01-08
    149 min

    [ABW-045]Ako Shiraishi Will Serve You Good Because She's A Super Newest Beauty Salon Addict 51 She'll Satisfy Her Customers' Desires And Provide The Ultimate Refreshment For Their Rock Hard Cocks!!

  • akiko shiraishi censoredcosplaysingle workABWprestigecharlie nakataabsolutely wonderfulABW-045ABW045118abw00045
    • 2021-01-08
    108 min

    [ARM-941]If You're Going To Cum, Make Sure It's On My Tighs!

  • suzuka walnut sarina kurokawa censoredARMaroma planninghamu oujiaromaARM-941ARM941arm00941
    • 2021-01-08
    183 min

    [NHDTB-478]Annual Custom - Private School Senior's Culture Festival Booth Is Secretly A Swinger's Club

  • censoredschoolgirlNHDTBnatural highlemonheart nakajimaNHDTB-478NHDTB4781nhdtb00478
    • 2021-01-15
    177 min

    [REAL-757]Tokyo Style Squirting Beauty Natsuki - Natsuki Kisaragi

  • natsuki kisaragi censoredcreampieamateurREALreal worksreal real worksREAL-757REAL757172real00757
    • 2021-01-16
    49 min

    FC2PPV 1646670 [Uncensored / No Mo] Buyer review benefits available (High-quality version) _ [It’s not bad to take it off] Misa (Rise, Meru) / 20 years old / College student [Complete appearance] Clothed raw SEX

  • amateur uncensoredfc2
    • 2021-01-16
    240 min

    [HUNBL-029]Girls G*******ged In Their Own Homes By Intruders Until They Stop Resisting - Made To Take Creampie After Creampie

  • censoredcreampieHUNBLhunteraldebaranhhh groupHUNBL-029HUNBL029hunbl00029
    • 2021-01-29
    64 min

    FC2PPV 1664296 [Uncensored] Dating transcendental beauty horny beauty member with chestnut stimulation Oma ● Ko juice dripping raw squirrel cum shot copulation !!: Reina (25 years old)

  • amateur uncensoredfc2
    • 2021-01-31
    100 min

    [VENX-002]Stepmom/Stepson Sex Two Seconds After Her Husband Leaves Rin Azuma

  • dongguan censoredcreampiemature womanVENXvenusmajime kitanofakecest winntersVENX-002VENX002venx00002
    • 2021-02-07
    96 min

    [VENX-004]I Mistook My Stepmom's Booty For My Wife's From Behind, And Stuck My Dick In Her By Accident. Ayane Sezaki

  • ayane sezaki censoredcreampiebig titsVENXvenuspeterfakecest winntersVENX-004VENX004venx00004
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-25
    58 min

    [orec-696]なつ

  • amateur censoredcreampieamateurorecorec-696orec696orec-696
    • 2021-03-01
    70 min

    326PAPA-028 [Daddy activity infiltration, Aimi-chan edition] F cup whitening milk trimmer GET with the super famous daddy activity application “Shi ● Gada ● i” ☆ Make clear pure white skin flush and shoot in the mouth & cum shot 2 conse

  • amateur censoredcreampieamateurpapapapa-028papa028326papa-028
    • 2021-03-06
    135 min

    [JUL-488]This Legendary Actress Is Starring In A Serious Drama, No.1 In An Exclusive Series!! When We Were Young, I Used To Play With Her, But Now That She's All Grown Up, I Realized, For The First Time, That She Was My Favorite "Madonna,&quo

  • kazama yumi censoredbig titsmature womanJULmadonnahiroyuki kimuraJUL-488JUL488jul00488
    • 2021-03-07
    128 min

    [SNTJ-018]Former Rugby Player Takes Her to a Hotel, Films the Sex on Hidden Camera, and Sells it as Porn. vol. 18

  • censoredamateurbeautiful girlSNTJsojitsusha mousouzokuSNTJ-018SNTJ018sntj00018
    • 2021-03-09
    46 min

    S-Cute smj_005 Gonzo H with a beautiful leg sister / Natsu

  • natsu censoredamateursmjsmj-005smj005smj-005
    • 2021-03-12
    45 min

    HEYZO 2505 Creampie in America #Chanel – Chanel

  • chanel uncensoredheyzo
    • 2021-03-19
    60 min

    [sika-051]まどかちゃん(18)

  • amateur censoredcreampiesquirtingsikasika-051sika051sika-051
    • 2021-04-09
    120 min

    [DASD-848]A Woman Addicted To Throat Fucking

  • censoreddeepthroatDASDdasDASD-848DASD848dasd00848
    • 2021-04-10
    143 min

    [APOD-047]I Want Cock... Sumire Is The Super Aggressive Type With A Big Ass And Tits Who Screams When She Cums

  • censoredbig titsamateurAPODapollo daydreamersapollo apollo daydreamersAPOD-047APOD047apod00047
    • 2021-04-25
    62 min

    SIRO-4500 [First shot] [Piston with stakeout ass] [Standing back with beautiful legs] A receptionist with beautiful legs with outstanding style, whose gentle way of speaking drives lust. Frustrated OL shakes her big butt violently on a man as if to d

  • amateur censoredamateursirosiro-4500siro4500siro-4500
    • 2021-05-04
    140 min

    [STARS-377]My G-Spot Is In My Titties ... The Sensual Nipples And Titties Of A Beautiful Girl Who Can Cum Just With Her Boobs Himari Asada

  • himari asada censoredbig titsbeautiful girlSTARSsod creategoemonsod starSTARS-377STARS3771stars00377
    • 2021-05-07
    112 min

    [RCTD-400]A Strategy To Influence Women In Mourning!？ A Pretty Beauty Turns Into A Dark, Filthy And Vulgar Woman In Mourning!？

  • miko shion suzuka walnut censoredslutRCTDrocketroute yamazakiRCTD-400RCTD4001rctd00400
    • 2021-05-10
    67 min

    326URF-058 [Back customs] [Four consecutive shots of angry waves] [Creampie in Reiwa’s nice ass princess] Fluffy loved BODY looks like an idol! However, the true nature is raw SEX that is watered down by a super gap of sperm madness! !!

  • amateur censoredcreampieamateururfurf-058urf058326urf-058
    • 2021-05-21
    84 min

    494SIKA-088 Bring Drunk Kyaba Miss To The Hotel And Spree Saddle

  • amateur censoredcreampieamateursikasika-088sika088494sika-088
    • 2021-05-22
    243 min

    [GIGL-647]It's True That Out In The Country, There's Nothing To Do But Fuck... In This Quiet, Isolated Village, We Met This Wonderful Old Lady With A Gentle Smile And An Organic Natural Airhead Body Trained In The Great Outdoors Who Showed Us

  • yoshizawa nasakura shimazaki kasumi censoredmature womanGIGLgigolo gigolojun nagasawagigoloGIGL-647GIGL647gigl00647
    • 2021-05-27
    146 min

    [MOND-215]I'm In Love With My Female Boss Yuna Mitake

  • yuna mitake censoredsingle workMONDtakara eizoshun bisakudaiichi housouMOND-215MOND21518mond00215
    • 2021-05-28
    56 min

    FC2PPV 1841342 * Monthly limited 2980⇒1980pt ★ First shot ☆ Rainy day married woman! A beautiful mom with a child gets a vaginal cum shot with another stick ♥ Sakura’s 23 years old ☆ Electric Maiki ♥ Intense cancer thrusting bicubic faint in ago

  • amateur uncensoredfc2
    • 2021-06-10
    104 min

    [SPRD-1422]My Mother-In-Law's Much Hotter Than My Wife... Yumiko Sakura

  • yumiko sakura censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1422SPRD142218sprd01422
    • 2021-06-17
    486 min

    [KTSG-013]Clothed Sex Daydream THE Kahanshin Tigers BEST Collection 8 Hours, Part 3

  • even aihara yamamoto miwako censoredbukkakeKTSGlower body tigers delusion grouplower body tigersKTSG-013KTSG013ktsg00013
    • 2021-06-19
    150 min

    [CAWD-231]Kawaii* Exclusive Part Two! Let's Give Miina Konno Her First Orgasm! She's Pounded And Pounded Again All The Way To Bliss! Keep On Thrusting 'Til She Cums!

  • miina konno censoredsquirtingCAWDkawaiicomet akaiCAWD-231CAWD231cawd00231
    • 2021-07-09
    147 min

    [IPX-693]If You Don't Want to Be Caught, Take Off Your Clothes. Shopping Lifting Beauty...You Can't Go Home. Insistant Tragedy. Minato-kun Women's Edition Yume Nishimiya

  • yume nishinomiya censoredcreampiedeepthroatIPXidea pocketkyouseitissueIPX-693IPX693ipx00693
    • 2021-07-09
    184 min

    [JUNY-038]She looks just like that famous pretty volleyball player! With her voluptuous thighs and a big ass, she's a well-proportioned beauty. Siori Kimura's AV debut!!! This former volleyball player who has slept only with two men and you w

  • shiori kimura censoredbig titssingle workJUNYfitchnikuyokuJUNY-038JUNY038juny00038
    • 2021-07-17
    62 min

    Pacopacomama 071721_504 Beautiful Mature Lady Bringing a Sex Stool Gives Perfect Pleasures Junko Kunida

  • amateur uncensoredpacopacomama
    • 2021-07-31
    74 min

    FC2PPV 1948375 [○ Pond Meat Forest] Virgin-Kun, A Big Orgy In The Wilderness! A 〇 Can 〇, Open-Air Bath, Double Blowjob, Big Tits Fucking Anything

  • amateur uncensoredfc2
    • 2021-08-06
    118 min

    [MIMK-093]I Just Had To Fuck Her Again! So I Asked My Stepmom, And She Let Me. 2 - New Sensation - Sex In The Family - Live-Action Adaptation Part 2! Yu Shinoda

  • shinoda yu censoredcreampiemomMIMKmoodyzkubo stylemankitsuMIMK-093MIMK093mimk00093
    • 2021-08-13
    191 min

    [ROYD-066]My C***dhood Friend And Little Stepsister Love Me So Much That They Fight Over Tempting And Fucking Me. Aoi Kururugi, Yuna Himekawa

  • aoi kururugi ran tsukishiro yuna himekawa censoredsisterROYDroyalkawajirihhh groupROYD-066ROYD066royd00066
    • 2021-09-06
    53 min

    292MY-499 Nakanishi Misuzu 1

  • amateur censoredmarried womanamateurmymy-499my499292my-499
    • 2021-09-11
    163 min

    [URPW-053]A Free-For-All Fuck Fest With Our Favorite Big Tits Waitress! I Had All The Ejaculations And Creampie Sex I Could Ever Want With These 3 Divine Titty Babes Ruka Inaba Sarina Momonaga Mizuki Yayoi

  • inaba sarina momonaga censoredcreampiebig titsURPWunfinishedrolandoppainURPW-053URPW053urpw00053
    • 2021-09-18
    148 min

    [MYBA-038]A Married Woman"s Blooming - Ai Hiraoka

  • ai hiraoka censoredmature womansingle workMYBAhitodzumaengokai emanuelkiiroi hyouMYBA-038MYBA038myba00038
    • 2021-09-24
    119 min

    [ISRD-005]Stewardess In... (Coercion Suite) - Rei Kuruki

  • satoshi kuruki censoredsquirtinguniformISRDdream tickettakuanvivid dori muchikettoISRD-005ISRD00524isrd00005
    • 2021-09-24
    45 min

    FC2PPV 2245120 [Personal Shooting] Chifuyu 18-Year-Old Busty F Milk Girl Cum Shot [Mountain Shooting]

  • amateur uncensoredfc2
    • 2021-10-14
    95 min

    [KAAD-058]My Family"s Beautiful Mother-In-Law Chisato Shoda

  • shota chisato censoredcreampiemature womanKAADcenter villagesouthern earthhanazono center villageKAAD-058KAAD058h-086kaad00058
    • 2021-10-15
    124 min

    [PPPD-970]Sex Development Until Your Balls Are Empty While You Are Restrained! <Penis Play-Rapid Fire-Male Squirting> Ejaculation M-sexual Health Riho Fujimori

  • riho fujimori censoredbig titssingle workPPPDoppaiPPPD-970PPPD970pppd00970
    • 2021-10-19
    63 min

    FC2PPV 2358350 * Until 10/21 2980⇒1980 ★ First Shot ☆ Shock! Even Though She Is A Virgin, She Was A Soap Lady, And She Was An Active Jd Glass 21 Years Old ☆ I Like Fierce ♥ Hand Man Blame Mass Squirting ♥ Vaginal Cancer Thrusting In Agony ♥ * With Be

  • amateur uncensoredfc2
    • 2021-11-05
    197 min

    [HUNTB-135]"Now Way... It"s Too Big! It Will Feel So Good Going In, But Weird Too. I Want It In. Wait, It"s Too Much!" (*Girls Thought About It For 0.1 Seconds) Results, Quickie.

  • censoredcreampieblowjobHUNTBhuntermorikihhh groupHUNTB-135HUNTB135huntb00135
    • 2021-11-06
    201 min

    [UMSO-423]Women With Colossal Tits Tend To Get Stiff Shoulders, So How To Solve That Problem？ They Need To Get Their Tits Rubbed At A Massage Parlor!! vol. 08

  • ena koume yoshine yuria censoredbig titsUMSOk m produceumanamiUMSO-423UMSO423umso00423
    • 2021-11-12
    119 min

    [MIAA-532]One Day, This Secretly Man-Hungry Freshly Graduated New Employee Deflowered My Cherry Boy Ass, And After That, My Cock And Her Pussy Fit So Well Together That She Treated Me Like Her Convenient Fuck Buddy, Even Though I"m Still Her Boss

  • hitomi hoshitani censoredcreampiebeautiful girlMIAAmoodyztaiga kosakaiminna no kikatanMIAA-532MIAA532miaa00532
    • 2021-11-19
    116 min

    [JUL-776]Gorgeous Housewife - Mayu Onodera Vol. 2! Her First Adulterous Drama! It All Starts With A Passionate Kiss...

  • mayu onodera censoredmature womansingle workJULmadonnamamezawa mametarouJUL-776JUL776jul00776
    • 2021-11-19
    110 min

    [VEMA-172]Beautiful Female Teacher"s Girlfriend Is My Class Homeroom Teacher, Club Advisor, And My Lover - Forbidden Passionate Creampie Sex With Older Girlfriend From Morning Till Night - Kana Morisawa

  • kana morisawa kanako iioka censoredcreampiemature womanVEMAvenuskaniemegami venusVEMA-172VEMA172vema00172



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored