censored amateur beautiful breast javcensored high visio




FC2AWDFSDSSONEZCJODWANZKSBJHNDMARACESDVEMAMVSDATIDSQTESHKDAPODHODVMILKEBODPPPDDASD

2020-09-10
120 min

[FSDSS-091]Amazing Body Bared In Tight Cosplay, Sora Amakawa

  • tenkawa sora censoredbig titscosplayFSDSSfalenoponyfaleno starFSDSS-091FSDSS0911fsdss00091
    • 2020-09-20
    97 min

    [KIR-017]Girl Thief Captured And Reformed Through Fucking... Toka Rinne

  • roaring sound censoredcreampiebig titsKIRstar paradisekirei star paradiseKIR-017KIR017h-254kir00017
    • 2020-09-24
    120 min

    [ARSO-20138]My Wife -Celeb Club- 138

  • ayami osako karen kawasaki censoredblowjobARSOaroundARSO-20138ARSO20138h-1378arso20138
    • 2020-09-26
    123 min

    [MIAA-321]I Accidentally Dropped My Sexiest Lingerie Onto The Balcony Below - Naughty Neighbor Gets The Wrong Idea And Ends Up Banging A Busty MILF All Night Long Mio Kimijima

  • kimishima mio censoredcreampiebig titsMIAAmoodyzham the mceveryone s porn starMIAA-321MIAA321miaa00321
    • 2020-10-27
    170 min

    [SDAB-149]Cool Face And Soaked Vagina: Marina Saito, Exclusive SOD AV Debut

  • marina saito censoreduniformschoolgirlSDABsod createkomatsu 17one s youthSDAB-149SDAB1491sdab00149
    • 2020-11-12
    83 min

    [IENF-108]A Massage Parlor Where They Always Play With Your Nipples

  • sarina kurokawa nanase mona censoredcreampiebig titsIENFienergyienfIENF-108IENF1081ienf00108
    • 2020-11-27
    300 min

    [WZEN-040]Other Men's Wives Are So Hot! Married MILFs Looking To Earn Some Secret Cash On The Side By Doing Porn!

  • censoredamateurblowjobWZENwaap entertainmentWZEN-040WZEN0402wzen00040
    • 2020-12-05
    165 min

    [DVDMS-608]Ordinary Guys And Girls Caught On Camera - Coworkers With Colossal Tits Get Tipsy, Hit On Their Boss, And Make Him Give Them Creampie Fucks Until Dawn (Role Reversal)

  • censoredcreampiebig titsDVDMSdeep sswing nagaseDVDMS-608DVDMS608dvdms00608
    • 2020-12-06
    39 min

    [ZOZO-022]Healthy P.E. At A Coed School 2020 3rd Period A Lesson On How The Female Vagina Works

  • censoredcreampiesquirtingZOZOsadistic villageZOZO-022ZOZO0221zozo00022
    • 2020-12-10
    50 min

    [MIHA-051]It's A Danger Day Fuck Fest!! You Get To Make Babies At This Soapland 25 Mr. Michiru 5th Year Anniversary Exclusive Actress Audition Judging The Acting Category Riko Sato

  • riko sato censoredcreampiebig titsMIHAmr michirusaitaMIHA-051MIHA0511miha00051
    • 2020-12-12
    49 min

    H4610 ki201213 Reika Hayano 19years old

  • amateur uncensoredh4610
    • 2020-12-12
    80 min

    300NTK-482 Saitama No.1 erotic god beautiful girl serves SEX! !! With the uniforms of the time (bringing ← here is important !!), the soft-shelled turtle escapes barefoot in the back of the throat. !! Even though my vision is clouded by tears of regr

  • amateur censoredcreampiesquirtingntkntk-482ntk482300ntk-482
    • 2020-12-19
    64 min

    488MCV-001 A case where a quiet female college student was actually lewd and defenseless

  • amateur censoredcreampiebig titsmcvmcv-001mcv001488mcv-001
    • 2020-12-20
    120 min

    [OFKU-169]The Bride's Mother Changing 3

  • ryoko sumida mikawa toki censoredblowjobmature womanOFKUstar paradisemom railOFKU-169OFKU169h-254ofku00169
    • 2020-12-22
    45 min

    [tkwa-140]たまき

  • amateur censoredsquirtinguniformtkwatkwa-140tkwa140tkwa-140
    • 2021-01-02
    49 min

    1Pondo 010221_001 Horny kimono beauty: Yukari Ayaka

  • amateur uncensored1pondo
    • 2021-01-10
    130 min

    [APNS-221]"The Guys Around My Neighborhood Use Me As A Fuck Toy..." No One Knows How I Really Am Ran Shiono

  • ran shion censoredcreampiebig titsAPNSaurora project annexyukihiro nasuaurora project anexAPNS-221APNS221apns00221
    • 2021-01-10
    61 min

    413INST-086 Yuna-chan JD 1 year 19 years old ☆ “I love my uncle ♪” Super × 3 Trottro ♪ A young man is not satisfied with a cuckold dick hold ☆ Dopyudopyu seeding SEX ☆

  • amateur censoredamateurbeautiful girlinstinst-086inst086413inst-086
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-02-05
    68 min

    FC2PPV 1672912 [No first shot] 145 cm minimum black hair Patsun girl Saori 19 years old 1 hour w [Personal shooting] I’m nervous about my first Gonzo

  • amateur uncensoredfc2
    • 2021-02-06
    120 min

    [JUL-459]She's Got Brains And Beauty - Hot MILF Madonna Exclusive Part 3! Your Mom's Friend Mayuka Kitagawa

  • mayuka kitagawa censoredbig titsmature womanJULmadonnajyoji kawaiJUL-459JUL459jul00459
    • 2021-02-12
    160 min

    [IPX-612]Hot Female Teacher's Tryst With Her S*****t - Passionate Love-Making POV Footage Record Karen Kaede

  • karen kaede censoredblowjobsingle workIPXidea pocketzaku araidishIPX-612IPX612ipx00612
    • 2021-02-13
    74 min

    275OCHA-081 Urarara

  • amateur censoredamateurbeautiful girlochaocha-081ocha081275ocha-081
    • 2021-02-17
    240 min

    [YVG-026]Perverted Slut Loves Licking Public Toilet Seats

  • censoredslutYVGgloryYVG-026YVG02613yvg00026
    • 2021-02-26
    61 min

    FC2PPV 1703436 [No] [Limited to 100 pieces 2980 → OFF to 1480pt!] Massive vaginal cum shot to a beautiful breast dental hygienist! ♥ ️ First Gonzo ♥ ️ ♥ ️ * Review benefits / Vibe Zubozubo Masturbation ♥

  • amateur uncensoredfc2
    • 2021-03-02
    87 min

    261ARA-478 [Extremely erotic BODY if you take it off] 24 years old [Miracle G cup beauty big breasts] This is coming! The reason for her application that she will appear on AV on the way home from work is “Masturbation is not enough …”

  • amateur censoredbig titsamateuraraara-478ara478261ara-478
    • 2021-03-03
    150 min

    [PFES-006]Married Secretary's Exposed Thighs Boss Humiliates Celibate Wife In The Office Marina Shiraishi

  • rena shiraishi censoredbig titsmature womanPFESmadonnajotaro tomisummer panties festivalPFES-006PFES006pfes00006
    • 2021-03-19
    100 min

    [VEC-470]My Friend's Mother And Me I Fucked Her Raw And Came Inside Of Her... Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiemature womanVECvenuspetermegami venusVEC-470VEC470vec00470
    • 2021-04-03
    46 min

    H0930 ori1597 Runa Funakura 34years old

  • amateur uncensoredh0930
    • 2021-04-06
    55 min

    FC2PPV 1750519 Finally Gonzo production lifted ❤️ It turns out that that God milk Menes Miss Sakura was actually a masochistic nympho ❤️ Seriously died 3 times with horse riding both legs closed play Many purchase benefits

  • amateur uncensoredfc2
    • 2021-04-08
    240 min

    [SVDVD-851]Girl Gets Horny From Aphrodisiac And Gets Her G-Spot Ravished With A Penis Ring! Lust Explosion Overdrive

  • censoredcreampiesquirtingSVDVDsadistic villagejiro tsubuyakiamateur back sadistic villageSVDVD-851SVDVD8511svdvd00851
    • 2021-04-15
    81 min

    [REBD-549]Yuuka Sexy monSTAR/Yuka Hoshi

  • yuka hoshi censoredsingle workREBDrebeccachikara sawamuraREBD-549REBD549h-346rebd00549
    • 2021-04-15
    18 min

    HEYZO 2499 A Titty Fuck with Hiromi – Hiromi Okura

  • hiromi okura uncensoredheyzo
    • 2021-05-03
    62 min

    Pacopacomama 050321_468 No bra wife who misleads her neighbor Sakiko Mihara

  • amateur uncensoredpacopacomama
    • 2021-05-07
    85 min

    380SQB-100 Kurumi

  • amateur censoredamateurbeautiful girlsqbsqb-100sqb100380sqb-100
    • 2021-05-08
    270 min

    [NSPS-993]Wives Fucked By Huge Dicks Best Edition

  • rio miyamoto hotaru mori censoredmature womandramaNSPSnagae stylehidetora moriNSPS-993NSPS993nsps00993
    • 2021-05-21
    60 min

    494SIKA-089 Make A Pet Of A Countryside De M Kyaba

  • amateur censoredcreampieamateursikasika-089sika089494sika-089
    • 2021-06-04
    64 min

    230OREC-788 Mao

  • amateur censoredcreampieuniformorecorec-788orec788230orec-788
    • 2021-06-05
    58 min

    FC2PPV 1854491 ☆ First shot ☆ Complete appearance ☆ Beautiful girl cafe clerk who looks good with black hair short ♥ Serious vaginal cum shot SEX while blushing fair skin body ♥ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-06-07
    59 min

    328HMDN-369 [Married Woman / Personal Shooting] Former model G Cup president’s wife 28 years old. Roppongi 48th Floor Tawaman House / Frustration Married Woman Is Fucked By A Big Cock And The Climax Of Delight! The bottom man wants vaginal cum s

  • amateur censoredcreampiemarried womanhmdnhmdn-369hmdn369328hmdn-369
    • 2021-06-10
    124 min

    [FSDSS-233]Devilish Y********l Who Loves Older Men Controls Their Ejaculations At Her Whim No Matter How Many Times She's Already Made Them Cum Hiyori Yoshioka

  • hiyori yoshioka censoredbeautiful girlhandjobFSDSSfalenopenisonicfaleno starFSDSS-233FSDSS2331fsdss00233
    • 2021-06-29
    47 min

    FC2PPV 1893598 ♪♪ Excavation ♪♪ Mai-chan 25 years old Super cute fair-skinned H-cup large amount of breast milk mom and breast milk play-in-mouth firing ※※ with benefits ※※

  • amateur uncensoredfc2
    • 2021-07-17
    126 min

    [MISM-206]Perfect Masochist 20-year-old Girl Loves To Get Fucked So Crazy Hard That She Cums Out Of Control! Yuri Omori.

  • yuri omori censoredcreampiebig titsMISMm girls labshura jinMISM-206MISM206mism00206
    • 2021-07-23
    107 min

    [SQTE-379]This Girl Is Amazing! G-Cup Big Titty Girl Bursts With Sweat And Sex Juices Rua Takashiki

  • takashiki censoredbig titssquirtingSQTEs cuteSQTE-379SQTE379sqte00379
    • 2021-07-30
    138 min

    [ATID-472]Midsummer Fuck: Anally Fucking My Daughter-in-law While My Wife Is Away Yui Kawagoe

  • yui kawagoe censoredanalsingle workATIDattackerstakuo ohtaniin madATID-472ATID472atid00472
    • 2021-08-13
    209 min

    [HUNTB-076]Reborn In Another World!？ When I Woke Up, I Don"t Recognize Where I Am ... A New Life I Knew I Nothing About Had Started. A Dream？ It"s Too Real To Be A Dream...

  • censoredcreampieblowjobHUNTBhuntermorikihhh groupHUNTB-076HUNTB076huntb00076
    • 2021-08-17
    56 min

    C0930 ki210817 Kikuko Akaishi 42years old

  • amateur uncensoredc0930
    • 2021-09-20
    32 min

    FC2PPV 2225938 Limited Number! [Uncensored] The Receptionist Of The Beauty Clinic Is Taken To An Outdoor Obscene Room In The Garden … And Vaginal Cum Shot Into An Elegant Body Wrapped In Beautiful Skin! !!

  • amateur uncensoredfc2
    • 2021-10-07
    64 min

    10musume 100721_01 I Was Nervous At The First AV Shooting, But When I Inserted A Vibe, I Turned On The Erotic Switch Ayane Mizutani

  • amateur uncensored10musume
    • 2021-10-08
    58 min

    [100821_01][VR] 制服時代 〜先生の事を考えると夜も眠れません〜

  • amateur uncensored10musume
    • 2021-10-08
    123 min

    [NKKD-229]Traffic Accident Settlement NTR 2 - Mary Tachibana

  • tachibana mary censoredsingle workNKKDjet eizougroupNKKD-229NKKD229nkkd00229
    • 2021-10-13
    91 min

    546EROF-002 [Leaked] K Cup Gravure Private Co-Star And Gonzo Sex (Ena Koume)

  • amateur censoredbig titsamateureroferof-002erof002546erof-002
    • 2021-10-15
    122 min

    [TPPN-208]The Return Of The Sure Thing Misuzu Kawana The High Tide Of Excitement, Slathered With Sweat, Bodily Fluids, And Cum The Furious, Crashing Waves Of Ultimate Pleasure

  • misuzu kawana censoredsingle workbukkakeTPPNteppanTPPN-208TPPN208tppn00208
    • 2021-10-21
    140 min

    [STARS-462]朝ドラ系Newヒロイン!満天笑顔全力少女 西元めいさ AV DEBUT

  • nishimoto meisa censoredSTARSsod createhoshi shootsod starSTARS-462STARS462
    • 2021-10-23
    123 min

    [NSFS-036]Posted True Stories, Wife Involved In Incident 2 -Wife Becomes Target Of Men"s Lust-

  • ayaka muto rumi tadami censoreddramaNSFSnagae styletomitake taroNSFS-036NSFS036nsfs00036
    • 2021-11-06
    70 min

    H4610 tk0046 Aisa Katsura 20years old

  • amateur uncensoredh4610



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored