censored amateur jav hours more javcensored




FC2MIDEDTTHDKAGMEMHNDPPPDWAAAGVHCHRVAUKGADNWANZEBODMILKHZGDATIDRBDNATRNGODHODV

2020-11-10
63 min

SIRO-4317 [First shot] [Second person in life ..] [18 years old x innocent] The long-awaited college life, her head is crazy about naughty things. For a series of pleasures that can not be obtained alone .. AV application on the net → AV experience s

  • amateur censoredamateursirosiro-4317siro4317siro-4317
    • 2020-11-22
    172 min

    [AKID-078]College Girls Only! I Took Her Back To My Room After A Party And Shot A Secret Video. I Was Quiet About This And Went To AV no.42: Slutty Huge Breasted Girls, Creampie Edition: Mami/Approximate G-cup, 21 Years Old (She Likes Older Men, So S

  • censoredcreampiebig titsAKIDomochikaeri mousozokumanji groupAKID-078AKID078akid00078
    • 2020-11-26
    63 min

    [SIROR-038]The Work Of A Mature Woman For Rent - The Secret Side Of A Wife That Her Husband Will Never See - FILE NO.38

  • censoredcreampiebig titsSIRORdispatched.comSIROR-038SIROR038h-1492siror00038
    • 2020-11-29
    266 min

    [GAV-055]The Boobs Of A Girl So Beautiful She's A National Treasure vol. 3

  • censoredcreampiebig titsGAVgogo adult videosGAV-055GAV055gav00055
    • 2020-12-01
    119 min

    [C-2600]My Wife's Friend Ended Up Staying The Night In My Room She's A Married Woman, Her Name Is Reiko-san (Not Her Real Name), And She's 46 Years Old And I Went And Hit That Shit Like It Was The Natural Thing To Do

  • censoredmature womanCgogoskoichi takahashigogo s coreC-2600C2600140c02600
    • 2020-12-05
    118 min

    [JUL-392]Celebration! The 50th Work In The Series!! Mom's Friend - Hiroka Suzuno

  • hiroka suzuno censoredmature womanslutJULmadonnajyoji kawaiJUL-392JUL392jul00392
    • 2020-12-06
    39 min

    [ZOZO-022]Healthy P.E. At A Coed School 2020 3rd Period A Lesson On How The Female Vagina Works

  • censoredcreampiesquirtingZOZOsadistic villageZOZO-022ZOZO0221zozo00022
    • 2020-12-20
    138 min

    [DASD-784]This Big Tits Wife Was Susceptible To Suggestion And Although She Tried To Resist At First, She Has Now Become A Horny Bitch Kurea Hasumi Tsubasa Hachino

  • hasumi claire yano tsubasa censoredcreampiebig titsDASDdasrokusaburo mishimaDASD-784DASD784dasd00784
    • 2020-12-25
    482 min

    [IBW-808]"No More, Please..." Stepdaughters Ravished Over And Over By Their Stepdads - Footage Compilation 2 Discs, 8 Hours

  • amateur censoredIBWi b worksIBW-808IBW808
    • 2020-12-25
    63 min

    FC2PPV 1619446 [No vaginal cum shot] * Yuuri is the last work of 21 years old. When I made a vaginal cum shot without permission, I was broke with a apt … [Personal shooting]

  • amateur uncensoredfc2
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-31
    120 min

    [KSBJ-116]Adultery In Her Own Home Ayaka Mochizuki

  • ayaka mochizuki censoredbig titsblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-116KSBJ116ksbj00116
    • 2021-02-11
    63 min

    413INST-095 Manaka

  • amateur censoredcreampiebig titsinstinst-095inst095413inst-095
    • 2021-02-28
    103 min

    [SOAV-074]A Married Woman's Infidelity - Nono Yuki

  • yuki s censoredsingle workSOAVhitozuma engokai emmanuelleihyo kairoiSOAV-074SOAV074soav00074
    • 2021-03-21
    154 min

    [CAWD-198]Pale, Smooth Skin And Perky Nipples... This Young Teen Is Still Developing - Halfway Between A Girl And A Woman - Former C***d Star Hinano Aiuchi - Her One And Only Porn Debut

  • aiuchi hinano censoreduniformsingle workCAWDkawaiikannana dainanaCAWD-198CAWD198cawd00198
    • 2021-03-25
    110 min

    [SPRD-1390]Step Mother Creampie Woman Cummed In By Her Step Son For The First Time Yumiko Sakura

  • yumiko sakura censoredcreampiemature womanSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1390SPRD139018sprd01390
    • 2021-03-28
    71 min

    476MLA-035 [Daddy activity infiltration, Nagisa-chan edition] F cup big tits live house staff who are hungry for money and Ji ● Po in self-restraint life appeared! Ascension in agony at the grind cowgirl with outstanding rhythm! Cunnilingus cum with

  • amateur censoredbig titsamateurmlamla-035mla035476mla-035
    • 2021-03-28
    56 min

    491TKWA-069 Somehow Creampie From A Request To Handjob To Today’s Gal J ○

  • amateur censoredcreampieuniformtkwatkwa-069tkwa069491tkwa-069
    • 2021-05-01
    120 min

    [NACR-415]Are They Going To Taste-Test Each Other's Boyfriends!？ These Shaved Pussy Sisters Are Getting Wild For A Foursome Fuck Fest!! Chiharu Miyazawa Yuha Kiriyama

  • chiharu miyazawa kiriyama yuu censoredNACRplanet plusbito sakurananakuruNACR-415NACR415h-237nacr00415
    • 2021-05-01
    120 min

    [JUL-571]I Was Working As A Delivery Health Call Girl When I Happened To Meet My Old Teacher (A Serious Asshole) From My S*****t Days ... And Ever Since That Day, I've Been Under His Control And He Turned Me Into His Private, Personal Sex Pet ...

  • maina miku censoredbig titsmature womanJULmadonnarokusaburo mishimaJUL-571JUL571jul00571
    • 2021-05-14
    47 min

    285ENDX-342 A Female College Student With Cute Dimples! If you take it off, fair-skinned big tits will not stop masturbating with the desire to kiss a lot!

  • amateur censoredcreampieamateurendxendx-342endx342285endx-342
    • 2021-05-18
    35 min

    396BIG-101 Suzutama

  • amateur censoredcreampieamateurbigbig-101big101396big-101
    • 2021-06-01
    120 min

    [NACR-424]The Wife Next Door With Giant Tits Accidentally Entered The Wrong House Yuri Honma

  • really censoredcreampiebig titsNACRplanet plusdirector onanakuruNACR-424NACR424h-237nacr00424
    • 2021-06-14
    74 min

    328HMDN-372 Highest Peak H Cup Big Breasts Wife (27 Years Old) Nasty Cheating Wife Loves Handsome Dick. With a jubu wet raw pussy, let the cock crotch and make the milk fluffy and it is continuous! Massive ejaculation to an unequaled wife who invites

  • amateur censoredcreampiebig titshmdnhmdn-372hmdn372328hmdn-372
    • 2021-06-25
    121 min

    [WAAA-073]Targeted Mother And Daughter: I Was Fucked By My Daughter's Classmate - Arisa Hanyu, Nene Hatsuai

  • arisa hanyu arisu hanyu first love censoredcreampiebig titsWAAAwanz factorywanzWAAA-073WAAA073waaa00073
    • 2021-06-25
    120 min

    [WAAA-074]She Says, "I Told You, I'm Already Cumming!" During Endless Creampies! Yuzu Shirakawa

  • yuzu shirakawa censoredcreampiesquirtingWAAAwanz factorywanzWAAA-074WAAA074waaa00074
    • 2021-07-14
    65 min

    495MOJ-011 "riko & Arisa" Of A Good Friend Duo With A Lesbian After School Orgy

  • amateur censoreduniformamateurmojmoj-011moj011495moj-011
    • 2021-07-17
    169 min

    [ROE-001]Sudden Transfer To Madonna's New Label Monroe, Yumi Narisaki 46 Years, The Married Woman In Her 40s With The Most Beautiful Nipples Makes Exclusive Debut For Monroe

  • grace narisaki censoredbig titsmature womanROEmadonnamametaro mamezawamonroeROE-001ROE001roe00001
    • 2021-07-18
    122 min

    300MIUM-730 [Gal Dental Hygienist] Gcup Slender Big Breasts Daughter Rental As Her! Completely Rec The Whole Story That Was Spoiled Up To The Originally Prohibited Erotic Acts By Persuading! !! After Enjoying An Enoshima Date, Have A Rich Love Lover

  • amateur censoredcreampiebig titsmiummium-730mium730300mium-730
    • 2021-07-21
    166 min

    [DGCEMD-038]Streaming Exclusive! Comes With Bonus Footage First Anal Sex! Lewd Older Woman Goes Crazy For Anal Sex, So Much Better Than Regular Fucking, That Her Eyes Roll In Ecstasy!

  • kayo iwasawa censoredcreampiebig titsDGCEMDcelebrity friendsDGCEMD-038DGCEMD038dgcemd00038
    • 2021-07-23
    33 min

    HEYZO 2589 She Has Flexible Tits & Responsive Clit – Chisa

  • chisa uncensoredheyzo
    • 2021-07-23
    61 min

    328HMDN-385 [I’M Going With A Nipple! ] Health-Loving Married Woman 26 Years Old Milk To Be Stretched At The End Of Breastfeeding! Free Massage Pick-Up On Sns For Married Women Suffering From Stiff Shoulders. Pretending To Be A Treatment, The Ap

  • amateur censoredcreampiebig titshmdnhmdn-385hmdn385328hmdn-385
    • 2021-07-24
    240 min

    [MCSR-446]Married Woman Lesbian SEX: Women Falling Into Pleasure, 18 People, 4 Hours

  • censoredmarried womanlesbianMCSRbig mocalmasu guomuscatMCSR-446MCSR44657mcsr00446
    • 2021-07-27
    64 min

    Caribbeancom 072721-001 Prohibit masturbation and increase sensitivity! Massive squirting! Three consecutive vaginal cum shots! Runa Hinata

  • runa hinata uncensoredcreampiehandjobcaribbeancom
    • 2021-08-05
    44 min

    FC2PPV 1954736 (Appearance Of The Main Story) Amateur M-Chan Breeding Record Reward Meat Stick White Eyes Dying Edition "Ah" Ah …! Muzzle Gimojii "Ii … !! ///" Glinglin ♂ So Much That The Uterus Turns Over … Bonus Ant

  • amateur uncensoredfc2
    • 2021-08-28
    64 min

    SIRO-4605 [First shot] [Slender beauty] [Beautiful Momojiri] Discovered a beautiful receptionist with high quality parts in a delicate body. The more wrinkles are drawn between her eyebrows, the more the shocked body of the big cock falls to the bott

  • amateur censoredsquirtingamateursirosiro-4605siro4605siro-4605
    • 2021-09-17
    121 min

    [PRED-338]Shameless Sister-in-Law. Gorgeous Sister-in-Law With No Bra Or Panties Gets Tons Of Creampie Sex Action Ever Since That Day. Airi Kijima

  • airi kijima censoredcreampiesingle workPREDpremiumakai suiseielegancePRED-338PRED338pred00338
    • 2021-09-19
    79 min

    522DHT-0302 Living In Minami Aoyama X 3rd Year Marriage Big Breasts Wife Creampie Her Kana 30 Years Old

  • amateur censoredbig titsmarried womandhtdht-0302dht0302522dht-0302
    • 2021-09-25
    178 min

    [GIGL-661]This Married Woman Dropped Her Guard That Night, And Now She Was Being Paid A Night Visit ... She Pretended To Be A****p, But Couldn"t Resist The Pleasure, And Kept On Cumming, Over And Over Again

  • censoredamateurGIGLgigolo jigoropermagigoloGIGL-661GIGL661gigl00661
    • 2021-10-07
    56 min

    H4610 ki211007 Chikako Minowa 26years old

  • amateur uncensoredh4610
    • 2021-10-13
    120 min

    [268SPYE-275]整体師淫行マッサージスペシャル 6

  • amateur censoreduniformamateurspyespye-275spye275268spye-275
    • 2021-10-19
    39 min

    276KITAIKE-498 Aya-San

  • amateur censoredcreampiebig titskitaikekitaike-498kitaike498276kitaike-498
    • 2021-10-21
    483 min

    [FCDSS-016]Kaname Momojiri FALENO Exclusive Best 8 Hours. Road From Determined Debut to Glory Hole for Cherry Boys

  • kaname momojiri censoredbeautiful girlslutFCDSSfalenofaleno starFCDSS-016FCDSS0161fcdss00016
    • 2021-11-02
    149 min

    FC2PPV 2396163 [Yanja ● Control ● 󈧖 Member Leak] * Early Purchase Required * [cen]

  • amateur uncensoredfc2
    • 2021-12-04
    96 min

    [HOKS-107]The Obscene and Dirty Mother-in-Law

  • mihara sumire ryo fukutomi censoredbig titsmature womanHOKSfa pro platinumogurokku kinzoufa proHOKS-107HOKS107hoks00107
    • 2021-12-04
    60 min

    519MAZOF-027 Woman Ejaculating] Private School Music Teacher 27 Years Old [Video of the Century] Woman with Absolute Pitch, Massive Tide Injection Acme with Bone Vibration, Vibe with Double Sensitivity, Slender Body Convulsions Climax Real Maso Femal

  • amateur censoredcreampieamateurmazofmazof-027mazof027519mazof-027
    • 2021-12-11
    60 min

    Pacopacomama 121121_570 Mature Lady Piledriver Position BJ: Ai Yamamoto

  • amateur uncensoredpacopacomama
    • 2021-12-12
    42 min

    SKHO-020 Nozomi (Nozomi Kazama)

  • amateur censoredcreampieschoolgirlskhoskho-020skho020skho-020
    • 2021-12-17
    160 min

    [PRED-366]I Met A Woman In My First Soap Opera, And She Was My Female Boss At Work... We Had Sex Inside And Outside And Played Soap Opera Many Times. Yuki Takeuchi

  • yuki takeuchi censoredcreampiePREDpremiumlamb chopelegancePRED-366PRED366pred00366
    • 2021-12-25
    212 min

    [NSFS-054]The Secret Things You Can"t Tell Your Husband About Your Father-in-law And Wife Best

  • kimi and ayumi miho tsuno censoreddramaNSFSnagae stylejotaro tomiNSFS-054NSFS054nsfs00054
    • 2022-01-28
    161 min

    [BF-656]My Big Tittied Plain Looking Neighbor Uses Me To Satisfy Her Sexual Frustration, Starring Rino Yuki

  • yuki rino censoredbig titsblowjobBFbefreeroku yonBF-656BF656bf00656
    • 2022-01-29
    241 min

    [EMBZ-244]Housewives Fallen Into The Trap Of The Dark Massage Salon. They Are Given Resting Pills And Given A Creampie While In A Sleep, And After Waking Up, They Are Given Oil Treatment, And The Wombs Of The Wives Go Crazy With Domination.

  • kazumi ikeya nonomiya ran censoredcreampieEMBZjuku onna juku emmanuellejuku onna jukuEMBZ-244EMBZ244embz00244
    • 2022-02-11
    165 min

    [DVDMS-777]Milf With A Light Skin Big Ass Gets A Quickie When She Comes Over to Do Housework! Once This Married Woman Holds His Big Dick Captive She Uses It Like She Wants The Next Day, Getting Non-stop Creampie Loads Till She"s Satisfied 11. Min

  • mina kitano censoredcreampiebig titsDVDMSdeepswing nagaseDVDMS-777DVDMS777dvdms00777
    • 2022-02-18
    146 min

    [HMN-127]Ever Since She Was Little, I Fed Her Lots Of Milk, And I Raised My Stepdaughter To Let Me Have As Many Creampie Cum Shots As I Want, And Now That She"s Grown Up With J-Cup Colossal Tits, I"m Sending Her Out To Take Care Of A Horny Gu

  • suwon miso censoredcreampiebig titsHMNhon nakamametaro mamezawaHMN-127HMN127hmn00127
    • 2022-03-01
    58 min

    Pacopacomama 022922_613 Mature Woman In Her 50s As It Is Done Miyuki Kaneda

  • amateur uncensoredpacopacomama
    • 2022-04-01
    85 min

    393OTIM-106 [Delusional Subjectivity] Is It Okay To Serve As A Child？ Ovulation Day Child Making Service Maid Otokoto Rui

  • amateur censoredcreampieamateurotimotim-106otim106393otim-106



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored