censored bdsm javcensored jav




FC2NATRADNDTTGMEMSPRDAVSAWAAASQTESSNICJODCESDCAWDAWDJULMILKJUFEMEYDMARAVEMAHDKA

2020-11-01
135 min

[MRSS-098]"Let's Go To The Ocean Again Next Year, Just The Three Of Us..." To Pay For Her Stepson's Surgery, A Doting Wife Swears To Spend One Whole Year As A Rich Guy's Personal Cum Dumpster. Rei Aino

  • aino rei censoredcreampiebig titsMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-098MRSS098mrss00098
    • 2020-12-18
    88 min

    [MBRBM-011]Weekday OL: Weekend Gravure - Natsuki Koyama

  • natsuki koyama censoredbig titsMBRBMnctrMBRBM-011MBRBM0115141mbrbm00011
    • 2020-12-21
    11 min

    Caribbeancom 122120-001 Pussy Encyclopedia : Kana Takashima

  • kana takashima uncensoredcaribbeancom
    • 2021-01-21
    62 min

    H0930 ki210121 Nanako Shirai 23years old

  • amateur uncensoredh0930
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-03-06
    117 min

    [JUL-497]An Adulterous Vacation Under The Guise Of A Business Trip - Saeko Hiiragi

  • hiiragi saeko censoredcreampiebig titsJULmadonnaunicorn fukudaJUL-497JUL497jul00497
    • 2021-03-08
    94 min

    FC2PPV 1717759 [First time limited 1980] 150 cm B cup 40 kg ❤️ Anime voice child DOMO body sexless married woman ❤️ "Awesome … I can not do it at home …" ❤️ Squirting many times ❤️ Pile driving cowgirl ❤️ Authentic vaginal cum shot

  • amateur uncensoredfc2
    • 2021-03-12
    69 min

    [DHT-255]Snagging A Married Woman With A Huge Ass And A Body Shape To Die For! Miu 29 Years Old

  • censoredcreampiemarried womanDHThot entertainmentstudio zeroDHT-255DHT25559dht00255
    • 2021-03-12
    264 min

    [MDTM-711]Raw Creampie In Sexy, Cute College Girl I Met On An Amazing App 04

  • censoredcreampiebeautiful girlMDTMuchu kikakutetMDTM-711MDTM711h-585mdtm00711
    • 2021-03-13
    91 min

    390JAC-082 [Superb Venus BODY x Special G Cup x Raw Saddle 3 Barrage] Adult children are also innocent world in see-saw games of erotic and gal! The finest G milk style! Endless Saddle Tide! Tomorrow never knows to the other side of the climax with a

  • amateur censoredcreampiebig titsjacjac-082jac082390jac-082
    • 2021-03-16
    198 min

    [KIRE-029]A Real-Life Apparel Designer Who's Got "Wild Eros Company Style" And Will Step Out With Her Bra On Kozue Minami 26 Years Old Her Adult Video Debut

  • minami kozue censoredsingle workKIREsod createeasy matsumotobeauty kirei sodKIRE-029KIRE0291kire00029
    • 2021-03-20
    116 min

    [OFKU-176]How Do I Have Sex With The Beautiful Married Woman With Hot Legs Who Lives In The Same Apartment Complex As Me And Is Always Emitting Pheremones？ Yuri Tadokoro 38 Years Old

  • yuri tadokoro censoredcreampiemature womanOFKUstar paradisemom railOFKU-176OFKU176h-254ofku00176
    • 2021-03-21
    164 min

    [JUL-502]Electrifying Transfer Maiko Ayase Madonna Exclusive Debut! Steamy Lustful Sex 3 Video Special

  • maiko ayase maria sawaguchi censoredmature womansingle workJULmadonnamametaro mamezawaJUL-502JUL502jul00502
    • 2021-03-21
    149 min

    [CJOD-291]A Snack Bar Slut Mama With Rocket-Sized Titties Is Giving Me Creampie Nookie All The Time Hikari Sena

  • hikari sena censoredcreampiebig titsCJODchijo heavenhirokoji osakiCJOD-291CJOD291cjod00291
    • 2021-03-28

    10musume 032821_01 Make You Feel Good With My Mouth Kasumi Seno

  • amateur uncensored10musume
    • 2021-04-24
    117 min

    [VEO-042]Real Married Amateur's Porn Debut! Sensitive H-Cup Wife With Big Tits Cums Hard And Squirts - Accountant For A Major Company Yuki Akagi

  • yuuki akagi censoredcreampiebig titsVEOvenuspeterbornVEO-042VEO042veo00042
    • 2021-04-24
    75 min

    355OPCYN-163 Rian

  • amateur censoredbig titsamateuropcynopcyn-163opcyn163355opcyn-163
    • 2021-04-25
    45 min

    229SCUTE-1107 Tin (20) S-Cute Delicate Beautiful Girl And Creampie H

  • amateur censoredcreampieamateurscutescute-1107scute1107229scute-1107
    • 2021-05-01
    164 min

    [DOKS-542]Beautiful Y********l In School Uniform With A Hairy Pussy Urara Kanon

  • hanaoto urara censoreduniformschoolgirlDOKSoffice k sgonzaburo onigawaraDOKS-542DOKS54236doks00542
    • 2021-05-01
    189 min

    [BBAN-324]Female Teacher Lesbian Sex Servant H

  • yuri sasahara chiharu miyazawa censoredlesbianbdsmBBANbibianBBAN-324BBAN324bban00324
    • 2021-05-15
    50 min

    FC2PPV 1818524 [Rookie Erika Sister] Virgin-kun does not endure the sweet temptation of dirty words and shoots 2 with vaginal cum shot + handjob. Participants are too profitable! [4K undisclosed benefits available]

  • amateur uncensoredfc2
    • 2021-06-12
    122 min

    [SCOP-725]This Gal Was Wearing A Hoodie At Home But Not Wearing A Bra Or Panties And Totally Had Her Guard Down!! Even Though They Were StepB****************r, He Couldn't Control His Lust And In the End They Had Fakecest: Creampies Sex!! 2

  • censoredcreampiesisterSCOPscoopk taromousouzokuSCOP-725SCOP725scop00725
    • 2021-06-20
    112 min

    [XRL-012]Idol Applicant Training Course: Father's Interview! With Hikaru Minazuki

  • hikaru minazuki censoredcreampiedeepthroatXRLreal worksreal real worksXRL-012XRL012xrl00012
    • 2021-06-24
    104 min

    [SPRD-1425]The Prim, Pretty Married Woman Next Door Aki Misato

  • aki misato censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1425SPRD142518sprd01425
    • 2021-06-30
    111 min

    [RD-1064]Showa Era Indecent Drama - A 60-Something Wife Uses Her Body To Repay Her Husband's Debts So He Doesn't Lose His Position On The Town Council

  • toshiyo kitamura reiko kitagawa censoredmarried womanblowjobRDathena videomurayamaathenaRD-1064RD1064149rd01064
    • 2021-07-02
    101 min

    [SHKD-956]Escaped Prisoner - Mahiro Ichiki

  • mahiro ichiki censoredsingle workSHKDattackerskinsharkSHKD-956SHKD956shkd00956
    • 2021-07-05
    88 min

    FC2PPV 1904383 980 yen! The best masterpiece! !! [Director’s role] I’m flirting after dating Lori ♪ Cowgirl Saddle tide & self tide facial cumshot! Continuous convulsions climax with Ahegao Oho voice! !! Lori Big Breasts Moko-chan Chapte

  • amateur uncensoredfc2
    • 2021-07-06
    62 min

    HEYZO 2557 Orgasms With A Horny Pussy Girl Vol.18 – Asuka Motomiya

  • asuka motomiya uncensoredcreampieheyzo
    • 2021-07-07
    42 min

    FC2PPV 1908289 First shot! !! Limited number "Because I like it ♡" If you notice, that child is already an 18-year-old girl ◯ student! Fornication in secret with the daughter of a friend who likes uncle! !! It was the best day …

  • amateur uncensoredfc2
    • 2021-07-10
    124 min

    [MOPT-009]Submissive Men Are Made To Be Tied Up. Slut Turned On By Bondage. Mary Tachibana

  • tachibana mary censoredanalslutMOPTm o paradisemo tightMOPT-009MOPT009mopt00009
    • 2021-07-14
    153 min

    [HUNBL-053]Before I Knew It, My Room Had Become A Hangout Place For Runaway Barely Legal Babes! They Never Refuse Sex, And No Matter How Many Times I Cum Inside Them, They Never Complain. I Wonder How It Came To This ...

  • censoredcreampieschoolgirlHUNBLhunterbajiohhh groupHUNBL-053HUNBL053hunbl00053
    • 2021-07-16
    57 min

    FC2PPV 1925947 Half Price Of New Work During The Sale Period !! [No / Piece] Gonzo Of Exotic Super Slender Beauty! The Gun Thrust With A Big Cock Is Too Pleasant And The Last Is A Face Collapse Ww * There Is A High Quality Review Privilege

  • amateur uncensoredfc2
    • 2021-08-12
    110 min

    [FGAN-046]My Very Own Panty Shot Doll Luna - Luna Tsukino

  • tsukino luna censoredcosplaysingle workFGANfechi mefetish eyesFGAN-046FGAN046h-1440fgan00046
    • 2021-08-16
    31 min

    FC2PPV 2031941 First Shot! !! Limited Number! [Uncensored] Cheating For The First Time Without Telling Your Boyfriend! Creampie To A Beautiful Woman Who Met At A Town Con! !! (Blow Scene Appearance)

  • amateur uncensoredfc2
    • 2021-08-20
    240 min

    [MGDN-159]Stepmom Feast 4 Hours, Stepson Makes Her Cum...

  • sugawa yuzuki mari aso censoredmarried womanmature womanMGDNstar paradisemegadonMGDN-159MGDN159h-254mgdn00159
    • 2021-08-21
    28 min

    FC2PPV 2057112 [Uncensored] Umeda Freeter ② (Video Of Support 〇 That Is Vaginal Cum Shot And Reinserted For Money …)

  • amateur uncensoredfc2
    • 2021-08-24
    50 min

    H4610 ki210824 Maho Katsuragi 25years old

  • amateur uncensoredh4610
    • 2021-09-02
    64 min

    Pacopacomama 090221_526 The Training For Wife: Beautiful Wife who is My Sex Toy Loves to Be Dominated Hitomi Yoshimura

  • amateur uncensoredpacopacomama
    • 2021-09-24
    63 min

    10musume 092421_01 AV Production Company Employee Is Punished For Skipping Work Without Permission Kyoko Suzuki

  • amateur uncensored10musume
    • 2021-10-16
    119 min

    [USBA-036]A Middle-Aged Teacher Received Some Relentless Breaking In Training From A Devilish Beautiful Girl Natsu Tojo

  • natsu tojo censoredschoolgirlbeautiful girlUSBAavsusubashi suiavscollectorsUSBA-036USBA036usba00036
    • 2021-10-28
    111 min

    [SPRD-1475]I Like My Old, Decrepit Ex-Wife Better Than My Younger, New Wife ... Hitomi Misono

  • hitomi misono censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1475SPRD147518sprd01475
    • 2021-10-30
    68 min

    200GANA-2586 Seriously Nampa, First Shot. 1709 It’s Super Cute Even If You Remove The Mask! Fair-Skinned And Slender Legs! If You Take Off Your Pants, It’s Smooth And Smooth! A Carnivorous Gal Aiming For One-Chan Is Pierced In The Vagina On

  • amateur censoredamateurganagana-2586gana2586200gana-2586
    • 2021-11-04
    57 min

    230OREC-924 Chiharu (Chiharu Sakurai)

  • amateur censoredcreampieamateurorecorec-924orec924230orec-924
    • 2021-11-09
    80 min

    534IND-009 Rumored Super Popular Jimaru P Active Beautiful Girl And Translated Ali Yen Active Virgin W Manko Continuous Creampie 3p Creampie Video Outflow Ww Satisfaction Half-Satisfaction …

  • amateur censoredcreampiebig titsindind-009ind009534ind-009
    • 2021-11-14
    40 min

    FC2PPV 2431947 That Child Who Is Worried About The Cafe I Often Go To ・ First Shooting First Iki First Vaginal Cum Shot ※ Open Commemorative Special Price Ends Today

  • amateur uncensoredfc2
    • 2021-12-01
    120 min

    [AMBI-144]I Want To Do It With You!! Sexy Little Sister-In-Law Continues To Provoke Brother-In-Law Mitsuki Nagisa

  • scooping censoredcreampiebeautiful girlAMBIplanet plusbito sakuraanbibaresotsuAMBI-144AMBI144h-237ambi00144
    • 2021-12-05
    78 min

    345SIMM-680 [Girls ○ Students Won Only Gals ♪] Loose Socks With Short Skirts, 100 Gal Degree Of Nail Fluttering J ○ "Aya-Chan". Uncle Faint In Agony With Nipple Messing & Saliva Plenty With Long Nails W After Insertion, Icharab From The Wo

  • amateur censoredcreampieuniformsimmsimm-680simm680345simm-680
    • 2021-12-08
    112 min

    459TEN-028 [Cum In The Throat] No Extra Foreplay, No Null Foreplay! !! With Full Throttle, You Can Make A Real Metamorphosis Squid! !! !! "Woman With A Clitoris In The Back Of Her Throat" Has Arrived! !! Ji ○ Is Thrown Into The Throat And Cum

  • amateur censoredbig titssquirtingtenten-028ten028459ten-028
    • 2021-12-09
    48 min

    326KSS-004 [Abdominal Muscle X Slender = God Style] Gonzo Of Freeter Girls Who Earn Pocket Money With Daddy Activity

  • amateur censoredcreampieamateurksskss-004kss004326kss-004
    • 2021-12-09
    179 min

    [SUN-039]Lusty Reception Girl. Exhibitionist Presentation With Beauty Who Likes To D***k Anywhere

  • yui hatano censoredsingle workSUNsunbacon tanakaSUN-039SUN03913sun00039
    • 2021-12-17
    76 min

    [HEYZO-2690]Ena Requesting The POV Fuck Option -Yokohama-

  • ena uncensoredheyzo
    • 2021-12-24
    121 min

    [HMN-095]What Secrets Does This Popular Sports Caster Hide Behind Her Cheerful Smile？ After A Lovey-Dovey Date, She"ll Tease Your Cock With Blatant, Gentle Dirty Talk Until Your Boy Goes Insane, And Then She"ll Pick Your Bones Dry With Consec

  • takehiro tomiyasu censoredanalcreampieHMNhon nakamiyoshi rusherHMN-095HMN095hmn00095
    • 2022-01-13
    115 min

    [SDMU-974]人気同人サークル初コラボ おすゆり出版×SOFT ON DEMAND 男の娘×男の娘!？おすゆり恋愛ドキュメント

  • amateur censoredSDMUsodSDMU-974SDMU974
    • 2022-01-15
    61 min

    H4610 ori1771 Chiaki Komiyama 21years old

  • amateur uncensoredh4610
    • 2022-01-20
    68 min

    [413INST-202]【100年に一度の奇跡】爆乳Jカップ

  • amateur censoredcreampiebig titsinstinst-202inst202413inst-202
    • 2022-01-22
    121 min

    [JSOP-010]The New Beautiful Mature Woman In A Public Bathhouse. Intimate And Sticky High Class Bathhouse. Yumi Narusaki.

  • grace narisaki censoredmature womansingle workJSOPglobal media entertainmentyayoi nakanomature japanese soaplandJSOP-010JSOP010jsop00010



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored