censored best omnibus creampie hours more javcensored




FC2GMEMSQTEVEMASHKDGVHCESDDASDCAWDABWAMBIWANZMIDENGODFSDSSSSNICHRVAUKGMIAAAVSAVENX

2021-01-09
121 min

[MIDE-869]"You Want Me To Suck You Off, Mister？" Blowjob-Loving S********l In Uniform Swallows Older Guys' Rods Until They Blow! Rikka Ono

  • rokka ono censoredschoolgirlblowjobMIDEmoodyzsuisei akaimoodyz divaMIDE-869MIDE869mide00869
    • 2021-01-10
    328 min

    [NSPS-960]The Cuckold: Jealousy Fans The Flames Of Passionate Cheating Sex - Best Edition

  • yuri sasahara miki hayashi censoredmature womandramaNSPSnagae stylejotaro tomiNSPS-960NSPS960nsps00960
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-20
    72 min

    259LUXU-1366 Luxury TV 1355 Bijin Yomimo applies for AV! Beautiful big breasts shine on a slender body! “What kind of feeling is it that people can see sex …” It is a must-see for a beautiful woman with outstanding transparency to spri

  • amateur censoredbig titsamateurluxuluxu-1366luxu1366259luxu-1366
    • 2021-01-28
    52 min

    326HGP-015 [Strangling plea x Mazoiki] [Ecstatic pissing] Super beautiful style married woman with bad drinking and man habits! !! Dirty housewife who is married but catches a man at a joint party is de M nature bare libido elimination raw vaginal cu

  • amateur censoredcreampiemarried womanhgphgp-015hgp015326hgp-015
    • 2021-01-29
    32 min

    480FRIN-017 《Personal shooting / voyeur》 Affair sex video leaked between a certain storyteller’s G cup wife and a junior entertainer

  • amateur censoredbig titsmarried womanfrinfrin-017frin017480frin-017
    • 2021-02-09
    120 min

    [KTRA-273]A Slut All Over Her Stepbrother! A Super Lewd Stepsister's "How To Sex" Lesson - Aya Mamiya

  • aya mamiya censoredcreampieschoolgirlKTRAk tribeKTRA-273KTRA273h-094ktra00273
    • 2021-02-13
    47 min

    188HINT-0439 Kaede

  • amateur censoredsquirtingamateurhinthint-0439hint0439188hint-0439
    • 2021-02-19
    182 min

    [LZPL-057]First Lesbian Amateurs Only Squirting Championship: 1,000cc Spouting Challenge 2

  • censoredsquirtingamateurLZPLlesreultimate ryolezure playLZPL-057LZPL057lzpl00057
    • 2021-02-26
    43 min

    [CLO-129]A Stubborn And Relentless Massage Parlor Where, No Matter What Part Of Your Body Is Being Treated, They'll Always Make Sure To Drop By Your Nipples Meisa Chiba

  • chibana meisa censoredslutCLOchobitchchovicCLO-129CLO129h-1435clo00129
    • 2021-03-02
    50 min

    H4610 ki210302 Sarina Takahashi 22years old

  • amateur uncensoredh4610
    • 2021-03-19
    160 min

    [PXH-023]Porn Star Audition #005 #Sakura (19 Years Old) #Just The Right Amount Of Cushion #Soft Beautiful Skin #Immediately Gets Wet #Plump Delicious Thighs #Vegan #Community College S*****t

  • censoredcreampiesquirtingPXHprestigeprestige hmjmPXH-023PXH023118pxh00023
    • 2021-03-21
    162 min

    [HND-960]Banned From Her Signature Move! She Has To Forget She's A Porn Star And Seduce Men Like An Ordinary Girl For Passionate Creampie Sex Akari Mitani

  • mitani akari censoredcreampiesingle workHNDhon nakanao masakiHND-960HND960hnd00960
    • 2021-03-27
    80 min

    491TKWA-063 A Noh Weather Girl’s Minimum Female College Student Who Says "If You Have Fun In Life, It’s okay!"

  • amateur censoredcreampieamateurtkwatkwa-063tkwa063491tkwa-063
    • 2021-03-27
    66 min

    300NTK-542 [Ecchi Echi MAX Beauty H Cup Beauty Big Breasts Great Earthquake! !! ] A fleshly beautiful woman with sexual desire like a demon has arrived safely! !! If you give her a monophone actor Ji ○ Ko to her AV enthusiast of Echi Echi Mind! !! Fi

  • amateur censoredcreampiebig titsntkntk-542ntk542300ntk-542
    • 2021-04-01
    189 min

    [YMDD-210]Quickie Interviews With Shiro Mitsuboshi 2 - They Only Came To Talk, But Before They Knew It They Were Getting Drilled

  • kurosaki mika asami rena censoredcreampieamateurYMDDmomotaro eizoasakusa ga jirowakamomoYMDD-210YMDD210
    • 2021-05-02
    64 min

    188HINT-0454 Reika

  • amateur censoredcreampiemarried womanhinthint-0454hint0454188hint-0454
    • 2021-05-07
    120 min

    [MIDE-926]The Office Playboy Walked My Busty Girlfriend To Her Car And Now She's Not At Work Today... Nozomi Ishihara

  • ishihara hope censoredcreampiebig titsMIDEmoodyzsuisei akaimoodyz divaMIDE-926MIDE926mide00926
    • 2021-05-07
    119 min

    [MIDE-923]100 Days After Becoming A Private Tutor To A Rebellious Y********l, I Had Completely Become Her Servant Mia Nanasawa

  • nanasawa mia censoredbeautiful girlslutMIDEmoodyzmoodyz divaMIDE-923MIDE923mide00923
    • 2021-05-22
    65 min

    Pacopacomama 052221_480 Buy Your Underwear: Pussy slip t-back Junko Kunida

  • amateur uncensoredpacopacomama
    • 2021-06-04
    111 min

    [FTHT-015](Her G-Spot's Possessed! Orgasms Right Down To Her Womb!) The Ultimate Ecstasy! Peerless Cock Addicts Fuck Their Own Faces With Cock And Willingly Give Guys Rimjobs! Nipple Teasing And Pussy Destruction! "Let's Cum Together! Ple

  • censoredcreampieFTHTfalenodavielfalenotubeFTHT-015FTHT0151ftht00015
    • 2021-07-02
    170 min

    [DVDMS-685]Ordinary Couple Hidden Camera Footage AV Masturbate And Suck Nonstop!! Amateur College Girls Try To Suck Off Countless Cocks From Gloryholes! 6 Embarrassed While Being Surrounded By Fully Erect Cocks, These Wet College Girls Fuck And Get C

  • censoredcreampieamateurDVDMSdeep sfunky hasegawaDVDMS-685DVDMS685dvdms00685
    • 2021-07-04
    39 min

    FC2PPV 1903354 Until the 7th [Individual shooting] Prefectural Commercial Department ③ Spring break last library date. A large amount of vaginal cum shot on the day of ovulation at the hotel. She is a literary girl who has begun to awaken her metamor

  • amateur uncensoredfc2
    • 2021-07-09
    120 min

    [EBOD-843]1 Week Without Parents Being Home... Open To Sex Because We Were Born Overseas. Already Half-Naked Step-Sisters and Me 3 of Us Living Together Covered in Big Tits. Karen Aimi and Rika Aimi

  • karen kaede rumi tadami censoredbig titsblowjobEBODe bodykc takedaEBOD-843EBOD843ebod00843
    • 2021-07-10
    181 min

    [SQIS-054]180 Minutes Of Filthy Footage (Video)

  • censoredbig titsmature womanSQISfa proSQIS-054SQIS054sqis00054
    • 2021-07-18
    131 min

    [KATU-085]Perverted Bar Owner with Throbbing Nipples Colossal Tits Huge Ass Shaved Pussy Thick Slut

  • censoredbig titsslutKATUkatsuo bussan mousouzokumaglowKATU-085KATU085katu00085
    • 2021-07-22
    153 min

    [JUFE-313]Infinite Orgasms With Just Titty Teasing-Riho Fujimori

  • riho fujimori censoredslutsingle workJUFEfitchsamoariJUFE-313JUFE313jufe00313
    • 2021-07-30
    148 min

    [JUL-676]I Met My Teacher Again As A Callgirl -Ai Mukai

  • ai mukai censoredmature womansingle workJULmadonnakitorune kawaguchiJUL-676JUL676jul00676
    • 2021-08-01
    238 min

    [ZMAR-047]Marutto! Aira Hatta

  • yurika censoredcreampiemarried womanZMARplanet plusmaruttoZMAR-047ZMAR047h-237zmar00047
    • 2021-08-07
    169 min

    [SCPX-430]Teeny Tiny Micro-Bikini And Lotion Makes A Hot Amateur Cutie Blush - It Was Supposed To Be Thigh Sex But She Was So Slippery The Cock Slipped Right In! "I Said Not To Stick It In Me..." But Her Request Is Ignored And Results In A Ho

  • censoredcreampiebig titsSCPXk m producescoop kmpSCPX-430SCPX430scpx00430
    • 2021-08-17
    51 min

    499NDH-027 [Urgent Coverage] Affair Creampie Sex In Exchange For Rewards! A Married Woman With A Loose Purse Mouth And Ma ● Ko [Translation Ali Debt Wife Case 3]

  • amateur censoredcreampiebig titsndhndh-027ndh027499ndh-027
    • 2021-08-24
    51 min

    H0930 ki210824 Takako Sanada 29years old

  • amateur uncensoredh0930
    • 2021-09-11
    121 min

    [LUNS-082]Sixty Something Grandmother And Step Grandson 6

  • censoredcreampiebig titsLUNSluna shunkoushaLUNS-082LUNS082luns00082
    • 2021-09-18
    128 min

    [MKON-062]My C***dhood Friend Is About To Have Sex With My Male Friend. And I"m In Charge Of Filming It. Yui Nagase

  • yui nagase censoredcreampieslutMKONkaguya hime pt mousozokuyumesaki ichiroumikonMKON-062MKON062mkon00062
    • 2021-09-25
    240 min

    [BDSR-459][Total Private POV] Lovey Creampie Fuck 22 Women 4 Hours

  • censoredcreampieamateurBDSRbigmorkalbig mocalBDSR-459BDSR45957bdsr00459
    • 2021-10-01
    164 min

    [DVDMS-719]"I"m Married Now." Former Entertainer Mika Kisaragi In Lustful Fuck Covered In Juices

  • mika kisaragi censoredsquirtingsingle workDVDMSdeepsyo sukeDVDMS-719DVDMS719dvdms00719
    • 2021-10-14
    60 min

    285ENDX-364 Self-Proclaimed Libido Daimajin! Sensitive Unequaled Ma ○ Ko!

  • amateur censoredcreampieamateurendxendx-364endx364285endx-364
    • 2021-10-22
    45 min

    FC2PPV 2364186 Limited To 200 Pieces, Half Price 1280pt! [Transcendental Beautiful Girl, Full-Scale Fetish, Blowjob, Cum Swallow] Goddess! A Super-Luxury Membership Secret Club’S Push Newcomer Is A Transcendental Beautiful Girl With Outstanding

  • amateur uncensoredfc2
    • 2021-10-22
    159 min

    [CJOD-319]The Convenient Apartment Wife"s Midday Adultery. Countless Creampies Into The Frustrated Big Tits Body. Mina Kitano

  • mina kitano censoredcreampiebig titsCJODbitorendei yamaguchichijo hebunCJOD-319CJOD319cjod00319
    • 2021-10-29
    130 min

    [VEC-502]Mom"s Best Friend, Akane Soma

  • soma censoredcreampiemature womanVECvenuspe tamegami venusVEC-502VEC502vec00502
    • 2021-12-04
    130 min

    [GVH-324]Titty-Loving Shota-kun"s Lewd Prank Hana Himesaki

  • himesaki hana censoredbig titsschoolgirlGVHglory questtakahashi chitsujiGVH-324GVH324gvh00324
    • 2021-12-08
    93 min

    [ETQR-321][Daydream POV] Keep Playing with the Nipples! A Slutty Beautiful Girl Visits you to Give Pleasure, Meru Ito

  • ito meru censoredcreampieuniformETQRerotic timeETQR-321ETQR321etqr00321
    • 2021-12-09
    81 min

    413INST-190 [Fair-Skinned Slender / Goddess Milk JD] School Of Education Aiming To Be An Elementary School Teacher No Panties Date Outflow Of Abstinence 1 Month Muramura Limit Mass Cum Shot Sex

  • amateur censoredcreampiebig titsinstinst-190inst190413inst-190
    • 2021-12-11
    151 min

    [SCOP-749]The Horny Young Wife From Next Door Is Wearing A Tight Mini One Piece Dress And Using My Cherry Boy Cock Like Her Own Personal Dildo And Cumming Her Brains Out

  • censoredcreampiebig titsSCOPscoopk taromousouzokuSCOP-749SCOP749scop00749
    • 2021-12-15
    73 min

    546EROF-011 [Leaked] Popular Tik T ○ Ker (19) Kyushu Ben’s Young Beautiful Girl Gonzo Video In Tokyo

  • amateur censoredcreampieamateureroferof-011erof011546erof-011
    • 2022-01-12
    60 min

    10musume 011222_01 Chunky Cabin attendant: I want to get on your jumbo quickly Noriko Sasaki

  • amateur uncensored10musume
    • 2022-01-24
    48 min

    292MY-505 Yuki Katahira 1

  • amateur censoredmarried womanamateurmymy-505my505292my-505
    • 2022-01-27
    121 min

    [FSDSS-351]Each Thursday When My Wife Is Out Late For Lessons, I Enjoy Non-stop Cumming During Close And Passionate French Kissing Sex With My Employee Arina. Arina Hashimoto

  • there is hashimoto censoreddramaFSDSSfalenoyasujiro shidofaleno starFSDSS-351FSDSS3511fsdss00351
    • 2022-01-28
    240 min

    [CLUB-668]We Went Picking Up Girls And Took Home This Friendly Pair Of Girls We Met At An Izakaya. If We Quietly Have Sex, Will Their Tight-Legged Friends In The Next Room Get Horny And Let Us Fuck Them Too？ 31

  • censoredCLUBhentai gentleman clubCLUB-668CLUB668club00668
    • 2022-01-30
    61 min

    544IDJS-068 Megumi [Matching App] [Chubby] [Gonzo] (Nao Kikuchi)

  • amateur censoredamateuridjsidjs-068idjs068544idjs-068
    • 2022-02-08
    84 min

    230OREC-1012 Urara (Urara Kanon)

  • amateur censoredcreampieschoolgirlorecorec-1012orec1012230orec-1012
    • 2022-02-23
    20 min

    FC2PPV 2679930 [Personal Shooting / Creampie] Slut Wife Who Blames The Father’s Cock ②

  • amateur uncensoredfc2
    • 2022-02-23
    116 min

    [MIKR-011]Panty Thief Visits And Pretends To Collect Panties. Asks For SEX And Gets Raw Creampie

  • censoredcreampiemarried womanMIKRmr michirumr michiru s collection videoMIKR-011MIKR0111mikr00011
    • 2022-03-04
    75 min

    277DCV-201 Is It Okay To Send It Home？ Case.195 Gack Gaku Hee Hee Unnie "Iku Iku Iku ~~" Is Actually The First Time？ !! ⇒Cool Beauty Similar To Hiro * A * S That Captivates Men! Beautiful Busty E Cup! ⇒Although It Is A Martial Arts Gal …

  • runa censoredbig titsamateurdcvdcv-201dcv201277dcv-201
    • 2022-03-10
    122 min

    [UMD-818]I Was Lucky Enough To Discover Some Nip Slips, And Was Trying To Peek Without Getting Caught, But Maybe I Was Caught In The Act After All!？ 19 - The Yoga Instructor -

  • himesaki hana sarina momonaga censoredUMDleodragon nishikawaUMD-818UMD818125umd00818
    • 2022-03-18
    87 min

    AIMS-026 Tsubasa Odagiri / Bare Beautiful Girl

  • odagiri tsubasa censoredbeautiful girlsingle workAIMSmedia brandjelly beAIMS-026AIMS026301aims00026



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored