censored creampie def mature woman amateur




FC2DASDSQTEVENXSTARSAUKGHDKAMVSDCHRVBLKDTTCAWDAVSAATIDNATRAWDMIDVAPODPREDNACXNNPJ

2020-10-23
31 min

FC2PPV 1544254 Limited number [Individual shooting] Boyish beautiful girl x delicate G cup, seniors and juniors of the same middle school

  • amateur uncensoredfc2
    • 2020-10-25
    190 min

    [CEAD-321]Nipple Masturbation Ecstasy

  • yui hatano kato momoka censoredbig titsmature womanCEADceleb no tomoCEAD-321CEAD321cead00321
    • 2020-10-27
    78 min

    [MCKT-004]My Deathly Cute Fuck Buddy

  • censoredMCKTchikikikikama delusion groupMCKT-004MCKT004mckt00004
    • 2020-11-19
    225 min

    [HUNTA-891]My Private Tutor Makes Me Keep Fucking Her For Our Entire 2-Hour Lesson, Convulsing From Cumming And Getting Filled Up With My Cum! My Private Tutor Is A Total Pervert! It's Totally Exciting For Someone Like Me With No Sexual Experienc

  • censoredcreampiehandjobHUNTAhunterkawajirihhh groupHUNTA-891HUNTA891hunta00891
    • 2020-11-26
    205 min

    [PIYO-095]Hyoko Anniversary Celebration. Y********ls Who Can't Refuse - And The Older Guys Who Want To Give Them Creampies...

  • censoredcreampiesquirtingPIYOhyokopiero dagrey wolfPIYO-095PIYO0951piyo00095
    • 2020-12-01
    73 min

    [MBRAP-021]市川美里 アイドルのアナ*

  • misato ichikawa censoredMBRAPspice visualblue ribonMBRAP-021MBRAP021406mbrap00021
    • 2020-12-04
    54 min

    [lady-359]まこと(21)

  • amateur censoredamateurladylady-359lady359lady-359
    • 2020-12-06
    44 min

    [ZOZO-025]Healthy P.E. At A Coed School 2020 6th Period A Hands-On Sex Education Lesson

  • censoredcreampiesquirtingZOZOsadistic villageZOZO-025ZOZO0251zozo00025
    • 2020-12-14
    93 min

    [SHH-012]These Big Tits Sisters Don't Like Me, But I Loosened Them Up With Aphrodisiacs And Now They're Obeying My Every Order In A Reverse Threesome Fuck Fest My Niece Is A Naughty Bitch But She's Got A Hot Body

  • censoredbig titssisterSHHnatural highkansukeSHH-012SHH0121shh00012
    • 2020-12-25
    51 min

    [MASE-010][Available Online For A Limited Time] 40-Something Mademoiselle Fucked And Creampied Trophy Wife Loses Her Mind Haru

  • censoredcreampiemarried womanMASEcrystal picturemadam maniac plusMASE-010MASE01049mase00010
    • 2020-12-31
    64 min

    336KNB-135 “My husband and wife are good! But I can’t see it as a man … “AV appearance in search of stimulation in ordinary everyday life! The young wife who screams in SEX for the first time in a long time makes her hair unkempt

  • amateur censoredmarried womanamateurknbknb-135knb135336knb-135
    • 2021-01-06
    46 min

    [sika-015]キララ(18)

  • amateur censoredschoolgirlamateursikasika-015sika015sika-015
    • 2021-01-21
    181 min

    [SW-752]Devilish Little Cutie With Big Tits And A Big Booty Awakens Her Inner Slut! Her Lover Turns The Tables On Her And Pounds Her With His Huge Cock!

  • censoredbig titsSWswitchyocchanswitch switchSW-752SW7521sw00752
    • 2021-01-22
    51 min

    [oretd-831]MIU

  • amateur censoredcreampiebig titsoretdoretd-831oretd831oretd-831
    • 2021-01-27
    127 min

    459TEN-011 [Extreme erotic degree No. 1] Charge to the home of an F cup gal captured in Shinjuku! !! Bombshell fuck with a special game underwear for gals! !! The scene is terrified by a drunken gal who gets erotic the more he gets drunk! !! !! Witne

  • amateur censoredbig titsamateurtenten-011ten011459ten-011
    • 2021-01-30
    150 min

    [MIDE-877]The H-Cup Colossal Tits Elder Sister Type Who Lives Next Door Is Luring Me To Temptation With Panty Shot Action And Gave Me Nookie Every Day Fumika Nakayama

  • nakayama fumika censoredbig titsslutMIDEmoodyzsuisei akaimoodyz divaMIDE-877MIDE877mide00877
    • 2021-02-01
    129 min

    [FLB-049]Ass Cheeks and Assholes Of Girls Cumming Hard

  • censoredsquirtingamateurFLBsarutoru video publisherfetish labFLB-049FLB049h-897flb00049
    • 2021-02-14
    54 min

    FC2PPV 1685582 [Individual shooting] Reunited with a foreigner half returnee J system, it seems to be addicted to being too nasty! [Appearance / Creampie]

  • amateur uncensoredfc2
    • 2021-02-19
    223 min

    [SIM-109]My Super Young Stepmom Is A Total Slut - She's Down To Fuck Her Stepson Any Time He Wants

  • censoredcreampieSIMprestigeamateur pussiesSIM-109SIM109118sim00109
    • 2021-02-22
    84 min

    [MCKT-016]Hot Girls Who Love To Party! Girls Pick Up Guys To Fuck On The Street Corner Hibiki Otsuki

  • otsuki sound censoredcreampieMCKTchikikikikama delusion groupMCKT-016MCKT016mckt00016
    • 2021-03-10
    40 min

    FC2PPV 1720567 Miyu 18 years old A teenage amateur I met on SNS! E-cup big breasts boobs x plump big peach butt! Creampie with seeds on a body that is too erotic and can be conceived specializing in SEX!

  • amateur uncensoredfc2
    • 2021-03-13
    129 min

    [AVSA-160]SUPER FISHEYE FETISHISM Thrilling And Exciting Angles A Voluptuous Flesh Fantasy Female Teacher Gal With A Super Erotic Body Shuri Hazuki

  • hazuki shuri censoredbig titssingle workAVSAavs collector sbuddha davscollector sAVSA-160AVSA160avsa00160
    • 2021-03-19
    120 min

    [KSBJ-123]A Son's Wife Gets Subjected To Daydream Fantasy NTR Nanao Nakano

  • nanao nakano censoredcreampieblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-123KSBJ123ksbj00123
    • 2021-04-16
    61 min

    Caribbeancom 041621-001 Debut Vol.66: Pure & Promiscuous Nana Nanami

  • nana nanami uncensoredcreampiecaribbeancom
    • 2021-04-30
    59 min

    C0930 ki210502 Misato Uemoto 21years old

  • amateur uncensoredc0930
    • 2021-05-01
    59 min

    324SRTD-0228 Kawaii OL, it was so sudden that I had to do 3P in the bathroom w

  • amateur censoredsquirtingamateursrtdsrtd-0228srtd0228324srtd-0228
    • 2021-05-02
    243 min

    [MMB-362]10 Sensitive Y********ls Open Their Legs Without Thinking After Getting Turned On By An Oil Massage

  • censoredMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-362MMB362mmb00362
    • 2021-05-03
    64 min

    FC2PPV 1799870 [3P orgy / pleasure training] My boyfriend told me … A girl who doesn’t know anything dedicates her undeveloped body to pleasure training for her boyfriend. Creampie sex to demon squid

  • amateur uncensoredfc2
    • 2021-05-06
    98 min

    435MFC-104 [JD of the body that fulfills all the desires of a man] Dense vaginal cum shot play with "Sena" of an exceptional super-dimensional erotic body! Roll up that and this with your proud H cup boobs! [Shiroto Gonzo ＃ Sena ＃ 20 years ol

  • amateur censoredcreampiebig titsmfcmfc-104mfc104435mfc-104
    • 2021-06-16
    119 min

    [TPPN-197]Ultimate First Ascension! Aoi Mukai She's Lost Her Mind! Wet Grinding Private Parts Bursting With Pussy Juice Sex So Wild That It Put Her In A Trance

  • ai mukai censoredblowjobsingle workTPPNteppanTPPN-197TPPN197tppn00197
    • 2021-06-20
    240 min

    [OKAX-746]Amateur Girls Fainting In Agony! Unscrupulous Aphrodisiac Oil Massage Parlor 240 Minutes

  • censoredamateurOKAXk m producedick mandokuokazuOKAX-746OKAX746okax00746
    • 2021-07-08
    56 min

    515BTGL-011 Misakura (21)

  • amateur censoredcreampieuniformbtglbtgl-011btgl011515btgl-011
    • 2021-07-08
    119 min

    [FGAN-043]Daydrem Confession Bloomers Girl Mayu

  • censoredcreampieFGANfechi mefetish eyesFGAN-043FGAN043h-1440fgan00043
    • 2021-07-17
    139 min

    [JUL-652]An Adultery Trip That I'm Calling A "Business Trip" Marina Shiraishi

  • rena shiraishi censoredcreampiebig titsJULmadonnamametaro mamezawaJUL-652JUL652jul00652
    • 2021-07-24
    56 min

    FC2PPV 1939015 * Limited Time 2980⇒980pt ★ First Shot ☆ Youthful Petit Pichi Active Jd Akane-Chan 19 Years Old ☆ Bing On Ball Licking Blowjob ♥ Raw Squirrel With Glue ♥ Gun Thrusting And Finally Unauthorized Vaginal Cum Shot ♥ ※ There Is A Privilege

  • amateur uncensoredfc2
    • 2021-08-01
    104 min

    345SIMM-656 A Lewd Girl With A Strong Libido Again! Reunion With J-Type Urara Who Can’T Stand The Simple And Innocent Face And Natural Untreated Pubic Hair! Dirty Little Urara, Who Gets Horny Even During A Date In Odaiba, Pulls Out An Old Man In

  • amateur censoredcreampieuniformsimmsimm-656simm656345simm-656
    • 2021-08-18
    16 min

    10musume 081821_01 Secret Pussy Collection: Hibiki Sakurano

  • amateur uncensored10musume
    • 2021-09-01
    120 min

    [GVH-284]Dirty Wife With No Bra And Panties Moves In Next Door Karen Asahina

  • karen asahina censoredslutsingle workGVHglory questkisakura kabinGVH-284GVH28413gvh00284
    • 2021-09-02
    118 min

    [MILK-118]Creampie Sex While Nodding Off, The Sought-After High S*********l, Ruha. Ruha Yamaguchi

  • yoko yamaguchi censoreduniformbeautiful girlMILKmilkMILK-118MILK118h-1240milk00118
    • 2021-10-01
    118 min

    FC2PPV 2283182 Until 10/3 (Sun) 980pt [None] A Super-Large Volume Of About 2 Hours With A Set Of 2 Works! !! Naked Close Contact With Udon Life Nozomi & Bloomers ♪ * High Quality Review Benefits Available

  • amateur uncensoredfc2
    • 2021-10-02
    242 min

    [MMB-387]The Best Part Of Sports Day Is Beautiful Girl Pussy Hard Cock Creampie Exercise!!! I"m Lost When It Comes To Exercise, And It"s Sports Day And I Need It, So I Tried Out Hard Cock Physical Training With My Crush"s Pussy! Without A

  • censoredcreampiebeautiful girlMMBmomotarou eizou shuppanishikiribashi hakasemomotaro bestMMB-387MMB387mmb00387
    • 2021-10-05
    54 min

    Pacopacomama 100521_541 Wives Drink Cum 120 Rinko Kondou

  • amateur uncensoredpacopacomama
    • 2021-10-15
    123 min

    [FOCS-025]Serious Orgasms!! Ena Is Hooked On The Services At This Forbidden Oil Massage Parlor Her Sensitivity Is Rising With Spasmic Ecstasy! Ecstasy! Ecstasy! A Full Orgasmic Course Of Cum Crazy Sex Ena Satsuki

  • ena satsuki censoredblowjobbeautiful girlFOCSabc mousou zokufocusFOCS-025FOCS025focs00025
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-10-29
    161 min

    [MIFD-187]Slightly Boyish and Slightly Sensitive 19 Year-Old Downtown Exotic Chic Phillipina Mixed-Race Beautiful Girl AV Debut Ran Ayase

  • ran ayase censoredbeautiful girlsingle workMIFDmoodyztorendei yamaguchimoodyz freshMIFD-187MIFD187mifd00187
    • 2021-11-12
    119 min

    [MUDR-168]Three Days in Hell Experienced By One Girl. Nightmare At the Altar. Small S&M Offering. Himari Kinoshita

  • himari kinoshita himari hanazawa censoredschoolgirlbdsmMUDRmukuMUDR-168MUDR168mudr00168
    • 2021-11-12
    118 min

    [MIAA-526]First Ever Girlfriend So Had SEX and Creampie Practice With C***dhood Friend. Noeru Honda

  • honda noeru censoredcreampieschoolgirlMIAAmoodyzminna no kikatanMIAA-526MIAA526miaa00526
    • 2021-11-27
    99 min

    [MDVHJ-043]「お義父様、許してこれ以上されたら私は…」夫の父の絶倫肉棒にイキまくる嫁… 七瀬いおり

  • iori nanase censoredbig titssingle workMDVHJgurafiteijapanmovieMDVHJ-043MDVHJ04348mdvhj00043
    • 2021-12-04
    58 min

    1Pondo 120421_001 Service Maid Who Is Good At Sexual Processing Emi Sakurai

  • amateur uncensored1pondo
    • 2021-12-16
    15 min

    [HEYZO-2679]Mio Futaba A Titty Fuck with Mio

  • mio futaba uncensoredheyzo
    • 2021-12-21
    61 min

    [122121_574]万引き主婦の結末

  • amateur uncensoredpacopacomama
    • 2022-01-07
    128 min

    [FTHT-037](An Arousing Revival？) More Lewd Than Ever Before! Drawn In With Chaotic Enchanting Words To Be Possessed Into Amazing Lewdness？!) Her Tight Pussy Has Enough Power To Stop A Vibrator! Amazing Pressure From Her Pussy! 100 Megapascals! (Picki

  • censoredcreampieFTHTfaleno tubedavielFTHT-037FTHT0371ftht00037
    • 2022-01-24
    49 min

    292MY-507 Madoka Kurihara 1

  • amateur censoredmarried womanamateurmymy-507my507292my-507
    • 2022-01-27
    122 min

    [FANH-063]The Best Office Worker"s Pill Sex Sex With A Woman Who Has Sex With A Woman 2 Consecutive Climaxes Before Fainting Begging For Raw Dick

  • censoredcreampieamateurFANHhamedori.network secondeditionFANH-063FANH063h-1472fanh00063
    • 2022-02-05
    240 min

    [YLWN-201]I Creampied The Bride"s Mother... 4 Hours

  • censoredmature womanYLWNyellow moonpappan tateishiYLWN-201YLWN201ylwn00201
    • 2022-02-05
    103 min

    [HNM-012]Karina... As A Submissive Slut Totally Broken In Bondage Bitch Karina Nishida

  • nishida karina censoredbdsmsingle workHNMavs collector susubashisuiblack mariaHNM-012HNM012hnm00012



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored