censored def shame amateur javcensored




FC2MEYDPREDMIDVAWDSSNIWAAANACRMILKAMBIJULABWSQTEDASDGMEMCJODNATRSDABSPRDKBICESD

2020-10-09
156 min

[MDBK-134]Cum Around The Clock - You Can't Leave Until This Busty Proprietress Gets 10 Loads - Soothing Sex At A Hot Spring Hotel

  • sachiko inaba censoredbig titsMDBKk m producerakudabazookaMDBK-134MDBK134h-1496mdbk00134
    • 2020-10-10
    144 min

    [IPIT-007]Banging The Best Girl All Night Long... Lust-Starved Couple Doing The Nasty At A Hotel Arisu Nanase

  • alice nanase censoredblowjobbeautiful girlIPITidea pocketinaballideapocket talent discovery projectIPIT-007IPIT007ipit00007
    • 2020-10-23
    81 min

    484SD-007 Aya-chan

  • amateur censoredamateurhandjobsdsd-007sd007sd-007
    • 2020-10-29
    51 min

    FC2PPV 1551055 [First 3P! Complete appearance! → It’s really dangerous if it gets caught] [NTR continuous launch] Former race queen JD! The second time is lightly 3P consent ❤ Dopyu cum shot in the mouth pussy & vagina pussy in red bloomers

  • amateur uncensoredfc2
    • 2020-11-07
    240 min

    [MMMB-035]Married Woman's Steamy Pantyhose Fragrance Temptation 4 Hours

  • censoredmature womanlingerieMMMBmellow moonpig momMMMB-035MMMB035mmmb00035
    • 2020-11-12
    123 min

    [SILK-131]Deep Desire V-break-

  • ashamed hanasaki ian censoredSILKsilk labokinoundressSILK-131SILK1311silk00131
    • 2020-11-16
    61 min

    SIRO-4319 [First shot] [Young limbs with strength] [Smile disappears ..] A shy 19-year-old female college student. If you toss her with a cute innocent reaction with adult technique .. AV application on the net → AV experience shooting 1393

  • amateur censoredamateursirosiro-4319siro4319siro-4319
    • 2020-11-19
    64 min

    [ETQR-164](Daydream POV Fantasies) The Obedient Beautiful Girl Secret Sex Club Yui Nagase

  • yui nagase censoredcreampieblowjobETQRerotic timeETQR-164ETQR164h-1186etqr00164
    • 2020-11-19
    172 min

    [SSNI-892]Keeping Me On The Edge With Peristent Teasing, Building Up To A Super Orgasm Breaking All Limits - Ichika Hoshimiya

  • ichika hoshimiya censoredsquirtingsingle workSSNIs1 no 1 stylemonSSNI-892SSNI892ssni00892
    • 2020-11-22
    91 min

    [HND-912]Fresh Graduate Finally Lands Her Dream Job At A Lingerie Maker, But Ends Up Getting Sexually Teased By All Their Other Employees Culminating In Big Creampie G*******g - Miyu Misaki

  • misaki misaki censoredcreampiesingle workHNDhon nakaHND-912HND912hnd00912
    • 2020-11-29
    85 min

    FC2PPV 1587044 [Forced impregnation NTR 2nd round! I will expose it even if it is said that it is absolutely useless] Since that child who was a former famous idol group joined, I was forced to conceive and gave a vaginal cum shot as a gift. I’m

  • amateur uncensoredfc2
    • 2020-12-09
    18 min

    FC2PPV 1600298 [No] Cum shot to H cup huge breasts married woman from sudden contact

  • amateur uncensoredfc2
    • 2020-12-11
    45 min

    [CLO-104]Look Me In The Eye While I'm Licking You An Mita

  • miharu kawada anri mita censoredblowjobbeautiful girlCLOchobitchchovicCLO-104CLO104h-1435clo00104
    • 2020-12-11
    94 min

    483SGK-006 [Glamorous Emperor] [Latin Big Breasts] [Open all year round horny beast] [Paipan] The 3 best Hs I’ve ever felt good about are … Rolls Royce, in the mountains, karaoke shops are abnormal, aren’t they？ Latin glamorous huge br

  • amateur censoredcreampiebig titssgksgk-006sgk006483sgk-006
    • 2020-12-18
    244 min

    [MBM-248]A Plump And Healthy-Looking Body Praise The Lord! A Power Spot Body!! She'll Bring Men Good Luck She's Got An Absolutely Lucky Pussy! Cum On Baby, Bring Me Some Luck! Enjoy Lucky Creampie Sex With A Lucky And Plump BBW MILF 12 Ladies

  • censoredbig titsamateurMBMprestigegaro sasazukambmMBM-248MBM248118mbm00248
    • 2020-12-20
    63 min

    HEYZO 2420 College Girl Gets Fucked – Mitsuki Harutori

  • amateur uncensoredcreampiehandjobheyzo
    • 2020-12-21
    103 min

    [NSPS-954]An On-The-Scene Report From An Adolescent Stepson And A Naughty Stepmom 3 - I Felt Strangely Jealous While Watching My Stepmom Get Fucked By Another Man - Hibiki Yonezu

  • yonezu hibiki censoredmature womanmomNSPSnagae stylejotaro tomiNSPS-954NSPS954nsps00954
    • 2020-12-26
    178 min

    [CLUB-624]A Stay-At-Home Wife Uses No-Bra Temptation To Have Sweaty Sex While Her Husband Is Away 4

  • censoredcreampiebig titsCLUBhentai shinshi clubCLUB-624CLUB624club00624
    • 2021-01-01
    67 min

    476MLA-016 The finest material with outstanding sensitivity found in the daddy activity app ☆ Unauthorized vaginal cum shot to a metamorphosis beauty college student who is obscenely swelling with the pleasure of old man Ji ○ port! !!

  • amateur censoredcreampieamateurmlamla-016mla016476mla-016
    • 2021-01-08
    57 min

    FC2PPV 1636947 When I forcibly inserted G huge breasts with a plump naked body, I got angry on the way and it was canceled. It’s a pity that the pussy was bitchy! I wanted to have a vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-01-09
    119 min

    [IPX-593]My New Stepdad Keeps Making Me Fuck Him... Ema Futaba

  • futaba emma censoredblowjobbeautiful girlIPXidea pocketsuisei akaidishIPX-593IPX593ipx00593
    • 2021-01-11
    42 min

    362SCOH-031 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [Ze ● Two]

  • amateur censoredcreampieamateurscohscoh-031scoh031362scoh-031
    • 2021-01-17
    301 min

    [HOIZ-012]Hoi Hoi Cool 1 Amateur Hoi Hoi Z A Personal Video Session Beautiful Girls Meetup App POV Sex Amateur GIrls SNS Cum Face Semen Splatters Beautiful Tits Big Asses Neat And Clean Babes

  • censoredamateurbeautiful girlHOIZamateur seduction daydream familyHOIZ-012HOIZ012hoiz00012
    • 2021-02-05
    26 min

    318LADY-365 Mika

  • amateur censoredamateurblowjobladylady-365lady365lady-365
    • 2021-02-17
    60 min

    [sika-038]14番メロンちゃん 2(18)

  • amateur censoreduniformschoolgirlsikasika-038sika038sika-038
    • 2021-02-21
    233 min

    [REXD-353]Live Streaming Girls' Nightmare/Broadcasting Their Restraint Shame, "Eh, Really？" "Is This Real？" "It's All An Act, Isn't It？"

  • censoredcreampieamateurREXDreddogroupREXD-353REXD353rexd00353
    • 2021-02-23
    27 min

    FC2PPV 1698940 Limited treasured video [Individual] Wife before being pickled. .. Three forced vaginal cum shot that triggered a mental collapse for the first time being fucked by another stick

  • amateur uncensoredfc2
    • 2021-02-28
    160 min

    [LULU-058]After An Office Party, I Woke Up At My Big-Assed Female Boss's House! I Ended Up Giving Her Several Creampies As She Spent All Night With Her Pussy Tightly Clamped On My Dick Grinding Furiously Cowgirl-Style And Cumming Repeatedly. Rie

  • riho fujimori censoredcreampieslutLULUlunaticsvagmanLULU-058LULU058lulu00058
    • 2021-03-06
    48 min

    371AHSHIRO-175 Yuki / Shinohara couple / Matsushima / Mizutani couple

  • amateur censoredbig titsamateurahshiroahshiro-175ahshiro175371ahshiro-175
    • 2021-03-19
    119 min

    [BKD-259]Stepmother/Stepson Fucking (The Black Forest Road) Ayaka Muto

  • ayaka muto censoredmature womansingle workBKDrubykoji tsujitobijiBKD-259BKD259bkd00259
    • 2021-03-21
    117 min

    [DASD-831]It's Too Easy To Fuck Emotionally Fucked Women Landmine NTR Fun Momo Kato

  • kato momoka censoredcreampiebeautiful girlDASDdasrokusaburo mishimaDASD-831DASD831dasd00831
    • 2021-04-03
    169 min

    [ZMEN-082]Amateur Cosplayer Gets D**gged, R**es, and Cums! 12

  • narita tsumugi hinako mori censoredcosplayZMENz mennaveZMEN-082ZMEN082zmen00082
    • 2021-04-17
    117 min

    [NNPJ-441]Half-Japanese, Half-Brazilian Hottie Working At A Brazilian Wax Parlor - When She Sees A Cock, She Wants It Inside Her - Her Porn Debut Naomi Luiza Yamashita

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-441NNPJ441nnpj00441
    • 2021-04-24
    100 min

    [SOAV-076]A Married Woman's Desire For Infidelity - Komari Ono

  • komari ono censoredbig titssingle workSOAVhitozuma engokai emmanuelleihyo kairoiSOAV-076SOAV076soav00076
    • 2021-04-24
    41 min

    [OSST-010]We Discovered This Girl In South Korea Who Loved To Party At Night, But She Had Been Celibate For A Month, And Now She Was At Her Absolute Limit!？ Her G-Spot Is In Her Feet, So When We Give Her A Tickle, That Sends Her Cumming Through The R

  • censoredamateurOSSTpatzkin amateurbooker tulchan amateurOSST-010OSST010h-1450osst00010
    • 2021-05-28
    120 min

    [ISRD-002]The Receptionist Is In ... (The Coercion Suite) Alice Otsu

  • otsu alice censoredbig titssquirtingISRDdream tickettakuanvivid dream ticketISRD-002ISRD00224isrd00002
    • 2021-06-05
    140 min

    [PKPD-148]Amateur Fuck Buddy Documentary - Kinda Sorta Almost My Girlfriend - Record Of A Creampie Fuck With My Fuck Buddy Riku, An Office Lady With Colossal I-Cup Tits - Riku Serina

  • serina riku censoredcreampiebig titsPKPDfuck group and fun friends daydreamersPKPD-148PKPD148pkpd00148
    • 2021-06-20
    240 min

    [SCPX-427]Seduced By My Sister-In-Law - He Never Had A Chance to Resist Her! Easy Cheating Creampie!

  • censoredcreampieSCPXscoopSCPX-427SCPX427scpx00427
    • 2021-07-17
    65 min

    SIRO-4584 [First Shot] [Beautiful Busty Active College Student] [Indecent Sound Stakeout Straddling A Man] A Nice Body Beautiful Girl With An Idol Face Appears. She Is Admired By An Actor Who Crouches Her Face In Her Crotch And Releases Her Sexual De

  • amateur censoredbig titsamateursirosiro-4584siro4584siro-4584
    • 2021-07-22
    118 min

    [MIDE-954]It was Only Her First Time, but with Nothing Else to do Out in the Countryside, All We did was Have Endless Sweaty SEX. Nana Yagi.

  • nana yagi censoreduniformbeautiful girlMIDEmoodyzshiro shotenmoodyz divaMIDE-954MIDE954mide00954
    • 2021-07-23
    91 min

    [sqb-111]ゆきの

  • amateur censoredbig titsamateursqbsqb-111sqb111sqb-111
    • 2021-08-06
    119 min

    [IPX-710]求む！舐めチン！無差別おしゃぶり！ 彼女が噂の即尺フェラヤリマン！ 西宮ゆめ

  • yume nishinomiya censoredschoolgirlblowjobIPXidea pockettissueIPX-710IPX710ipx00710
    • 2021-08-16
    54 min

    299EWDX-375 Celebrity Wife Likes His Wife! Dirty Talk And Disturbed De M Wife And Creampie Sex

  • amateur censoredcreampiemarried womanewdxewdx-375ewdx375299ewdx-375
    • 2021-09-01
    123 min

    [NACR-459]Oil Mania Mai Satsuki

  • satsuki mei censoredcreampieblowjobNACRplanet plushimurokkushichi ku ryuuNACR-459NACR459h-237nacr00459
    • 2021-09-04
    141 min

    [PKPD-157]Young, Raven-Haired, Amateur S********l In Pantyhose Is Down For Fucking Raw, Starring Inori Sasage

  • dedication glue censoredcreampiebeautiful girlPKPDpakopako team and pleasant friends delusion groupPKPD-157PKPD157pkpd00157
    • 2021-09-10
    156 min

    [IPX-726]A Lucky Lady Who Gives Instant Hard Ons Sucks Cock Once She Is Called The Best Blowjob Giving Girlfriend. "I Want All Of Your Cum In My Mouth" (9 Continuous Oral Cumshots!!) Kana Momonogi

  • kana momonogi censoreduniformblowjobIPXidea pocketkyoseidishIPX-726IPX726ipx00726
    • 2021-09-12
    102 min

    390JNT-028 [Immediately, Raw Squirrel Is Excellent! ] ● Tender And “Immediately” Say “Immediately”! !! Matching With Max Girls Who Have An Inevitable Facial Deviation Value! !! If You Poke The Back Of Kitsuman With A Big Cock, A Large Amount Of Tide

  • amateur censoredcreampiesquirtingjntjnt-028jnt028390jnt-028
    • 2021-09-24
    86 min

    529STCV-018 Natsu (Natsu Tojo)

  • amateur censoredcreampieamateurstcvstcv-018stcv018529stcv-018
    • 2021-10-07
    84 min

    [inst-172]ナミ(22)

  • amateur censoredcreampiebig titsinstinst-172inst172inst-172
    • 2021-10-09
    124 min

    [BAVC-005]Fresh Face Office Lady Has An Older Man As Her Boss. The Office Is Closed Today So They Can Fuck All Day Long. Rui Minagawa

  • rui minagawa censoredslutsingle workBAVCbarutanusubashi suivictoriaBAVC-005BAVC005bavc00005
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-10-29
    125 min

    [WAAA-116]"EH! You Just Came Inside Me, Right？" Hiding Premature Ejaculation By Extended Piston After Explosion, Further Creampie Without Pulling out!! Noeru Honda

  • honda noeru censoredcreampieschoolgirlWAAAwanz factoryWAAA-116WAAA116waaa00116
    • 2021-11-06
    120 min

    [NASH-599]Working Mature Lesbian. Sweet Trap That Would Cause Any Woman To Become a Lesbian.

  • censoredlesbianmature womanNASHpinknadeshikoNASH-599NASH599nash00599
    • 2021-12-03
    178 min

    [DVDMS-747]Real Virgin. Young Woman From A Prep School For Girls - Aoi Kuraki. "I"ve Never Had A Chance To Interact With Men Until Now" College Girl With An Elite Education Loses Her Virginity For Her AV Debut.

  • kuraki aoi censoredsingle workDVDMSdeepssuttorune iwanagaDVDMS-747DVDMS747dvdms00747
    • 2021-12-10
    145 min

    [BBAN-352]Minami Hatsukawa and Rika Aimi Lesbian Document

  • hatsukawa minami rumi tadami censoredlesbianbeautiful girlBBANbibianBBAN-352BBAN352bban00352
    • 2021-12-17
    120 min

    [MIAA-548]Seductive Female Boss Showing Off Her Ass With Open Crotch Stockings To Invite An Adulterous Office Quickie Yu Shinoda

  • shinoda yu censoredslutsingle workMIAAmoodyzeighteveryone s porn starMIAA-548MIAA548miaa00548



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored