censored gal javcensored delusion group jav




FC2DASDKBIWANZCAWDSHKDADNSPRDMEYDWAAACESDNNPJSANNACXJUFEFSDSSBLKNACRCHRVIPXRBD

2020-11-12
144 min

[YAKO-019]A Very Nice Sex Friend - Weird, Big Titted Ami

  • censoredcreampiebig titsYAKOmercuryshinjuku undergroundYAKO-019YAKO019h-1133yako00019
    • 2020-11-22
    79 min

    200GANA-2389 Seriously Nampa, first shot. 1557 Taiyaki caught a squeaky student! ？？ Eros is packed tightly instead of anko squeaky w Mochimochi is a perfect balance to eat with just the right texture!

  • amateur censoredbig titssquirtingganagana-2389gana2389200gana-2389
    • 2020-12-02
    77 min

    259LUXU-1350 Luxury TV 1334 Now is the season! A culinary researcher who is attracting attention with a glamorous body that is ready to eat appears on Luxury TV! “I want to taste intense sex …” Fucking wrapped in a plump H cup! A dexte

  • amateur censoredbig titsamateurluxuluxu-1350luxu1350259luxu-1350
    • 2020-12-04
    62 min

    417SRCN-057 [G cup neat office lady] A neat and clean beauty who is generously exposed on the stairs outside the company! My full erection Ji ● Po excited by her bold exposure masturbation is grasped with an erotic hand ….

  • amateur censoredcreampiebig titssrcnsrcn-057srcn057417srcn-057
    • 2020-12-11
    79 min

    FC2PPV 1603180 [First time limited 1980] Active JD 18 years old ❤️ Iku who was addicted to the pleasure of sex! Erogenous zone development for a child who does not understand ❤️ Iki spree no matter where I touch ❤️ Pleasure fell due to unmeasurable n

  • amateur uncensoredfc2
    • 2020-12-19
    68 min

    C0930 ki201220 Shiho Shimazu 28years old

  • amateur uncensoredc0930
    • 2020-12-19
    48 min

    398KAG-068 The frustrated body of a beautiful witch who still shines beyond the forties is out of control! !! A neat wife with an older husband is slammed with a big dick and a ceilingless gachiiki barrage ww

  • amateur censoredcreampiesquirtingkagkag-068kag068398kag-068
    • 2020-12-24
    93 min

    [OKP-074]Goddess Office Lady In Glasses - Sara Yurikawa - Enjoy Her Beautiful Legs Wrapped Up In Pantyhose, Including Her Toes And The Soles Of Her Feet! - Experience Face-Sitting, Footjobs, Assjobs, And Bukkake Fucking! - Perversion Training Has Her

  • yurigawa sara censoredsingle workbukkakeOKPdaddy s private photosgoro koenjigodly pantyhoseOKP-074OKP0741okp00074
    • 2020-12-27
    222 min

    [GONE-024]Shame Clan: 3 Amateurs LONGVERSION

  • censoredcreampieamateurGONEmercurya fair skinned elder sisterGONE-024GONE024h-1133gone00024
    • 2021-01-01
    130 min

    [ABW-042]All-Natural Pussy Juice- 120 Pure - 69 - Hard Sex Pushes The Limits Of Female Flesh

  • nagisa konomi censoredanalbig titsABWprestigecharlie nakataabsolutely wonderfulABW-042ABW042118abw00042
    • 2021-01-06
    63 min

    SIRO-4383 [First shot] [Back side of serious girls] [Dirty milk x obscene ass] A job hunting junior high school student who looks serious. The super erotic gap SEX, which is contrary to the appearance, is a must-see. Climax many times while waving be

  • amateur censoredamateursirosiro-4383siro4383siro-4383
    • 2021-01-12
    122 min

    [KTRA-265]Creampie For My Slender S********l Stepsister Hinako Mori

  • hinako mori censoreduniformslutKTRAk tribeKTRA-265KTRA265h-094ktra00265
    • 2021-01-12
    141 min

    [SDNM-264]Trembling With Thoughts Of her Husband, Too: A 4-Hour, One-Way Adultery Trip - Akemi Furuse, Age 33, Final Chapter - Letting Her True Inner Slut Show - A Night At A Hot Spring - S&M, Outdoor Three-Some, Anal, Enema, And Finally, A Creamp

  • akemi furuse censoredanalcreampieSDNMsod createevening editiongenuine married woman the porn experienSDNM-264SDNM2641sdnm00264
    • 2021-01-16
    146 min

    [SSNI-975]183 Furious Orgasms! 4270 Spasms! 10200ccs Of Squirts! She's Got Light Skin And A Slender Body That's Prone To Pissing And Now She's Experiencing An Eros Company Awakening Her First Massive Spasm & Flooding Pussy Special Mai

  • mai shiomi censoredsquirtingbeautiful girlSSNIs1 no 1 stylemon cSSNI-975SSNI975ssni00975
    • 2021-01-21
    66 min

    10musume 012121_01 Fucked and Cum Inside The Girl Who Got Completely Drunk

  • amateur uncensored10musume
    • 2021-01-21
    32 min

    FC2PPV 1654058 [No] Fair-skinned slender daddy active woman. Grasp the weakness and threaten to inject the gene into the raw vagina

  • amateur uncensoredfc2
    • 2021-01-22
    72 min

    FC2PPV 1654786 [Major company model] Leaked ● Hard raw acme SEX at a secret cosplay photo session. A narrow pussy is opened with a thick cock and acme died in a few minutes. Forced seeding as it is (leaked Gonzo data)

  • amateur uncensoredfc2
    • 2021-01-22
    63 min

    [oretd-837]ららちゃん

  • amateur censoredcreampieuniformoretdoretd-837oretd837oretd-837
    • 2021-01-31
    486 min

    [JUJU-265]The Sex She'll Never Tell Her Husband About "We Show You The Moment A Married Woman Decides To Cheat" Highlights Collection, 10 Girls, 8 Hours

  • censoredcreampiemature womanJUJUjukujo japanJUJU-265JUJU265juju00265
    • 2021-02-14
    73 min

    200GANA-2436 Seriously Nampa, first shot. 1598 Bring a female college student who came to Tokyo from Fukuoka but has no accommodation to the hotel! Good reaction barrage with SEX that was weak to push and accepted! Moe into a dialect that pops out oc

  • amateur censoredbig titssquirtingganagana-2436gana2436200gana-2436
    • 2021-02-28
    119 min

    [XVSR-581]Love For A C***dhood Friend - Stealing Her From Her Fiance And Having Creampie SEX - Mao Kurata

  • kurata mao censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-581XVSR581xvsr00581
    • 2021-03-06
    119 min

    [SSIS-008](Abnormal Extreme Climaxes) The Ultimate Erotic Awakening! Waves Of Surging Nonstop Carnal Passion Until She's Totally Satisfied Rena Kodama

  • kodama rena censoredsquirtingbeautiful girlSSISs1 no 1 styleichigoharaSSIS-008SSIS008ssis00008
    • 2021-03-06
    239 min

    [TSP-439]Drilled By A Massive Dick Hammer! Female Foreman Gets Drilled! "You'll Catch A Cold If You Lay Down Here..."

  • censoredcreampieamateurTSPtokyo specialmanji groupTSP-439TSP439tsp00439
    • 2021-03-12
    109 min

    [PAKO-032]Tall Big Titted Married Woman At The Pachinko Parlor

  • censoredbig titsamateurPAKOmercuryold lady fucking cafeteriaPAKO-032PAKO032h-1133pako00032
    • 2021-03-12
    27 min

    359TYVM-137 Kaho

  • amateur censoredcreampieamateurtyvmtyvm-137tyvm137tyvm-137
    • 2021-03-16
    70 min

    [CRNX-017]I Want To Lose My Virginity To My Step Sister! Angelic Step Sister Agrees To Become A Sex Practice Partner With Her Virgin Step Brother Who Got His First Ever Girlfriend

  • momose asuka censoredcreampieuniformCRNXcrystal pictureharuo miyafujicrystal nextCRNX-017CRNX01749crnx00017
    • 2021-03-19
    47 min

    FC2PPV 1671733 [Personal shooting] Appearance / Miya 20 years old / I’ve been doing all-you-can-eat, raw squirrel, and vaginal cum shot to a fair-skinned girl with big dicks! !!

  • amateur uncensoredfc2
    • 2021-04-03
    240 min

    [DSD-824]After School Naughtiness

  • molly bennett riley reid censoreduniformDSDmomotaro video publishingmarchinsweetdevilDSD-824DSD824dsd00824
    • 2021-04-10
    59 min

    FC2PPV 1762210 A teenage runaway girl. I quarreled with her parents and stayed at a manga cafe. * A work that could not be released for half a year. Please see at your own risk.

  • amateur uncensoredfc2
    • 2021-04-15
    41 min

    FC2PPV 1770970 [Personal shooting] ♀ 250 Reading More ◯ -chan 18 years old 8th time Creampie sex with a popular transcendental beautiful girl Saffle who continues until she gets pregnant!

  • amateur uncensoredfc2
    • 2021-04-22

    FC2PPV 1781883 New personal shooting Amateur active CA Due to a drastic decrease in work, a secret meeting with Succi! Part ⑤ First in-car blowjob !!

  • amateur uncensoredfc2
    • 2021-06-16
    120 min

    [FOCS-001]Super Sexy Poor Girl Who Lives At An Internet Cafe Even Though She's Hungry All She Wants To Do Is Keep Cumming Does She Love Men More Than Food？!

  • censoredblowjobbeautiful girlFOCSabc mousouzokufocusFOCS-001FOCS001focs00001
    • 2021-06-25
    121 min

    [MIAA-461]Even Though I'm A Teacher I Couldn't Resist My S*****t's Seduction And I Fucked Her Raw Over And Over At A Love Hotel After School... Ena Koume Hana Himesaki

  • ena koume himesaki hana censoredcreampiebig titsMIAAmoodyzsapporo taroeveryone s porn starMIAA-461MIAA461miaa00461
    • 2021-06-29
    49 min

    H4610 ki210629 Kazumi Hashino 18years old

  • amateur uncensoredh4610
    • 2021-07-10
    150 min

    [APKH-179]Creampie Love Hotel "Please, Don't Pull Out! Cum Inside Me!" Riko Shinohara

  • riko shinohara censoredcreampieschoolgirlAPKHaurora project annexhaurora project anexAPKH-179APKH179apkh00179
    • 2021-07-10
    156 min

    [MKMP-406]I was Continually and Single-Mindedly Fucked by Akari Nimura with my Back to the Setting Sun Melting into the Sky

  • akari shinmura censoredcreampieslutMKMPk m producesamoarimillionMKMP-406MKMP406mkmp00406
    • 2021-08-21
    193 min

    [SCPX-431]The Pushover Clerk Is Just My Type Fully Erect As We"re Alone In The Changing Room To Check My Pants "Sir...We Can"t Do This...not Here..." But She Can"t Take Her Eyes Off My Huge Cock Even Though

  • censoredcreampiebig titsSCPXk m producescoop kmpSCPX-431SCPX431scpx00431
    • 2021-08-24
    140 min

    [SDDE-655][Obon Special Sex] Summer In Countryside With Bombshell Lady

  • censoredbig titsdramaSDDEsod createkisshisenzSDDE-655SDDE6551sdde00655
    • 2021-09-10
    83 min

    [sqb-118]ももえ(23)

  • amateur censoredbig titsamateursqbsqb-118sqb118sqb-118
    • 2021-09-10
    45 min

    FC2PPV 2185081 [Individual Shooting] The Best! A Large Amount Of Vaginal Cum Shot That Miraculously Meets A Beautiful Big Tits Geki Kawa J System And Is Conceived By An Inspiring Raw Paco

  • amateur uncensoredfc2
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-29
    65 min

    318LADY-384 Ena / Rikako

  • amateur censoredamateurladylady-384lady384318lady-384
    • 2021-10-01
    67 min

    324SRTD-0249 Shaved Girl (Yuha Kiriyama) Who Gets Tired Of Sex With He And Puts In Herself With Her Ex-Boyfriend

  • amateur censoredcreampiesquirtingsrtdsrtd-0249srtd0249324srtd-0249
    • 2021-10-04
    56 min

    541AKYB-005 Yurie (20) G Cup Black Hair Beautiful Girl ♪ (Yua Takanashi)

  • amateur censoredcreampiebig titsakybakyb-005akyb005541akyb-005
    • 2021-10-08
    149 min

    [SKMJ-219]*Barely Legal *Absolutely No Condoms *A 19-Year Old Bares Her Erotic Soul On A Hot Spring Resort Vacation *A 4-Fuck Fuck Fest *A Budding Model

  • censoredcreampieamateurSKMJsekimenjoshikantori wajimasekimen goshiSKMJ-219SKMJ219h-1324skmj00219
    • 2021-10-23
    129 min

    [BHG-041]Colossal Tits Masked Hottie Succumbs To Sluttiness! Haruka

  • censoredcreampiebig titsBHGgeinko pore shongain corporationBHG-041BHG041bhg00041
    • 2021-10-28
    53 min

    FC2PPV 2381130 There Is A Reason Why It Has A Petite And Dangerous Scent. The First And Last Gonzo With A Girl Waiting For God! Relentless Raw Insertion From The Cross Missionary Position To Miraculous Beautiful Breasts

  • amateur uncensoredfc2
    • 2021-11-03
    152 min

    FC2PPV 2401036 [No] Carefully Selected Nuki! March 2019-August 2019 Digest Version ☆ Amateur Girls Brought To Shunsuke Shimoshin (And His Friends Ww) ♥ 16 Works Are Recorded In A Total Length Of Over 2.5 Hours! !!

  • amateur uncensoredfc2
    • 2021-11-18
    125 min

    [296CPDE-052]最強属性 52 若宮穂乃

  • amateur censoredcreampiebig titscpdecpde-052cpde052296cpde-052
    • 2021-12-10
    118 min

    [JUL-796]I, A Bullied Girl Whose Mother Was Ntr"d By A Classmate Who Bullied Her, Amakawa Minase

  • minase tianhe censoredmature womanmomJULmadonnajyoji kawaiJUL-796JUL796jul00796
    • 2021-12-17
    48 min

    230OREC-958 Kaede (Kaede Hiiragi)

  • amateur censoredcreampieamateurorecorec-958orec958230orec-958
    • 2021-12-29
    66 min

    FC2PPV 2551687 [Personal Shooting] God Times !! ★ 18-Year-Old Still Orthodox Beautiful Girl Gonzo Attending A Private Lady School !!

  • amateur uncensoredfc2
    • 2021-12-31
    77 min

    355OPCYN-223 Mio (Mio Mashiro)

  • amateur censoredamateurcosplayopcynopcyn-223opcyn223355opcyn-223
    • 2021-12-31
    63 min

    300NTK-679 [Active Hostess Libido Explosion] [No Bra X No Rubber Rich Customer Service] [Reverse Sexual Harassment Squeezing Cowgirl 2 Creampie! !! ] Sex Appeal Explosion! !! Actor Gon Attack With Greedy Greed Of Active Popular Hostess Miss No Bra Cu

  • amateur censoredcreampieamateurntkntk-679ntk679300ntk-679
    • 2021-12-31
    123 min

    [ADN-366]I Decided To Give My Ovulating Sister-in-law Creampie Sex In Place Of My Broke And Destitute Older Brother. Tsumugi Akari

  • akari tsumugi censoredcreampiesingle workADNattackersdragon nishikawaotona no dramaADN-366ADN366adn00366
    • 2022-01-01
    138 min

    [SOAN-069]MILF With Two K*ds Of Her Own Is Getting Both Of Her Holes Filled Again Today. Real Amateur Housewife That Thinks Her Husband Likes To Cheat Wants To Make Her Porn Debut Willingly. Sanae Sekikawa (Alias). Agrees To Cheating Anal Sex, Chapte

  • censoredamateurSOANyama to soramaketaro tanizokoanal visitSOAN-069SOAN069soan00069



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored