censored high vision creampie hours more jav




FC2SSNIHDKAHODVSQTEMARAJULATIDHMNAVSAMILKROYDNACRCHRVSHKDDASDMEYDHNDFSDSSMIAAVEMA

2021-01-29
125 min

[BANK-028]The Greatest Erotic And Cute Gal, With A Tight Waist! She's So Fucking Cute And She Cums With Spasmic Intensity A Slender Gal Itsuki Hasegawa

  • hasegawa ju censoredsingle workBANKpussy banktake chanBANK-028BANK028h-1495bank00028
    • 2021-02-06
    180 min

    [HUNTA-939]They'll Fuck Anyone For A Fixed Fee! If You Pay A Monthly Subion, You Can Fuck Any Of The Female Stuff At This Hospital! Creampie Sex Included! Why Not Try Becoming A Patient...

  • censoredcreampieblowjobHUNTAhunterkorosukehhh groupHUNTA-939HUNTA939hunta00939
    • 2021-02-09
    72 min

    FC2PPV 1679345 One month after the loss of virginity ❤️ It’s scary and painful, but … Black-haired slender JD cried again this time [Personal shooting]

  • amateur uncensoredfc2
    • 2021-02-19
    43 min

    FC2PPV 1692819 [Uncensored] Fitting using a matching app. Slender huge breasts that don’t look good on your face.

  • amateur uncensoredfc2
    • 2021-02-19
    69 min

    374SHOW-044 Nanase

  • amateur censoredamateurbeautiful girlshowshow-044show044374show-044
    • 2021-03-01
    67 min

    488MCV-010 The case that I was crazy about girls with literary glasses

  • amateur censoredamateurbeautiful girlmcvmcv-010mcv010488mcv-010
    • 2021-03-01
    303 min

    [DOKS-538]For Discerning Pantyhose Fanciers - Magazine Models With Beautiful Legs' Masturbation In Glistening Pantyhose BEST Collection 5 Hours

  • yumi konomi nao tachibana nauri uehara censoredslutDOKSoffice k sseichu matsumotoDOKS-538DOKS53836doks00538
    • 2021-03-12
    44 min

    [CLO-136]Uniform Trial - Hinata Suzuki

  • suzumori hinata censoreduniformblowjobCLOchobitchchovicCLO-136CLO136h-1435clo00136
    • 2021-03-12
    264 min

    [VPC-008]Super Erotic Amateur Self-shot Video Leak 08

  • censoredcreampiebig titsVPCprestigevideo podcastVPC-008VPC008118vpc00008
    • 2021-03-30
    31 min

    Pacopacomama 033021_453 POV from stalker Tsubaki Hosho

  • amateur uncensoredpacopacomama
    • 2021-04-18
    145 min

    [KSAT-037]Naughty Older Man Nails A Busty Married Slut And Films It Miu, Age 25

  • censoredcreampiebig titsKSATstrong woman s table daydream tribetable of a strong womanKSAT-037KSAT037ksat00037
    • 2021-05-13
    95 min

    [MHAR-002](The Men's Massage Parlor Everybody's Talking About) Mature Woman Masseuse's Secret Raw Creampie SEX Options 2

  • censoredcreampieamateurMHARmilf laboMHAR-002MHAR002h-1160mhar00002
    • 2021-05-14
    61 min

    383REIW-064 Riria

  • amateur censoredcreampieamateurreiwreiw-064reiw064383reiw-064
    • 2021-05-28
    153 min

    [MIFD-159]Amateur 20 Year Old I'm Having A Hard Time Being True To Myself Porn Debut Yuika Aoi

  • yuka aoi censoredbig titsbeautiful girlMIFDmoodyzusa pyonmoodyz freshMIFD-159MIFD159mifd00159
    • 2021-06-12
    138 min

    [TPIN-005]His Wife Is Right Beside Him, But ... While Giving Her Husband A Massage, This Massage Parlor Therapist Secretly Slipped His Cock Into Her Pussy And Hid The Deed Underneath Her Skirt And Creampie Fucked Him, And He Could Nothing But Go With

  • censoredcreampieTPINchinpoinTPIN-005TPIN005tpin00005
    • 2021-07-01
    60 min

    Pacopacomama 070121_497 Secret with the wife next door Reiko Shibata

  • amateur uncensoredpacopacomama
    • 2021-07-17
    167 min

    [SSIS-162]Previously Unreleased Video Premium Edition! Director's Cut You Get To Live Together With Saika And Get Lovey-Dovey With Her And Fuck Her Brains Out Saika Kawakita

  • ayaka hebei censoredbeautiful girlsingle workSSISs1 no 1 stylemon cSSIS-162SSIS162ssis00162
    • 2021-07-17
    102 min

    355OPCYN-171 Karen Asahina Karen

  • amateur censoredcreampiemarried womanopcynopcyn-171opcyn171355opcyn-171
    • 2021-07-20
    77 min

    [KIR-039]My College S********l Sister Was Fucked To Pay Off My Loans Misa Amagami

  • misa tenjo censoredcreampiesisterKIRstar paradisekirei star paradiseKIR-039KIR039h-254kir00039
    • 2021-08-06
    90 min

    [393OTIM-084]【妄想主観】会社の後輩とホテルで逆NTR不倫物語 天馬ゆい

  • amateur censoredcreampieamateurotimotim-084otim084393otim-084
    • 2021-08-31
    105 min

    451HHH-030 AV First Experience [F Cup! ] [Short Stature Gal! ] [Systemic Erogenous Zone] The Appearance And Tone Are The Minimum Gals Of The Saba Saba System! After All, I Like Flirting Sex While Saying Something Like "I Like Sex And I Want Money

  • amateur censoredbig titsamateurhhhhhh-030hhh030451hhh-030
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-16
    76 min

    [REBD-588]Amiri2 Summertime Lover - Amiri Saito

  • amiri saito censoredbig titssingle workREBDrebeccazack araiREBD-588REBD588h-346rebd00588
    • 2021-09-24
    237 min

    [SKMJ-210]Amateur Sch**lgirls In A Real Pickup! Male And Female S*****t Boys And Girls Are Out On The Street, And Taking The "If You Can Extract 20ml Of Semen, You"ll Win 100,000 Yen Variety Special" Challenge! She"s Blushing Like A T

  • censoredcreampiebig titsSKMJsekimenjoshikikufukusekimen goshiSKMJ-210SKMJ210h-1324skmj00210
    • 2021-09-24
    147 min

    [SSIS-188][VR] Rave Review ATTACKERS Titles - Special Selection Of 16 Titles, 640 Minutes. Long Scenes Only In This Best Of Collection.

  • izuna maki censoredsquirtingsingle workSSISs1 no 1 stylehasami kukaSSIS-188SSIS188ssis00188
    • 2021-10-01
    107 min

    [SHKD-965]That Night Where I Just Had To Creampie That Girl - Ichika Matsumoto

  • ichika matsumoto censoredsingle workSHKDattackersakawa yuushi yoru akuSHKD-965SHKD965shkd00965
    • 2021-10-14
    205 min

    [ABW-154]顔射の美学 17 美女の顔面に溜まりに溜まった白濁男汁をぶちまけろ！！ 時田萌々【MGSだけのおまけ映像付き 20分】

  • amateur censoredsquirtingamateurabwabw-154abw154abw-154
    • 2021-10-14
    125 min

    [AARM-025]All New Dirty-Talking Dildo Masturbation. Her Pussy Is Dripping Wet! 3

  • arimura nozomi chiharu miyazawa censoredAARMaroma kikakusatoshimaniaaromaAARM-025AARM025aarm00025
    • 2021-10-30
    125 min

    [MRSS-125]I Never Thought My Wife Was The Kind Who Would Commit Infidelity, But When I Peeked Into Her Smartphone, I Discovered That She Had Been Committing Adultery With The Guy At Her Hair Salon Mahiro Ichiki

  • mahiro ichiki censoredcreampiesingle workMRSSmisesu no sugao emanuelyumesaki ichiroumisesu no sugaoMRSS-125MRSS125mrss00125
    • 2021-11-05
    230 min

    [HUNTB-134]Repeat Customers Come Back For More! Not Allowed To Touch, But If You Ask This Fresh Face Female Masseuse Then She Can"t Back Down From Getting Fucked Raw Standing From Behind! Her Legs Just Quake In Pleasure! 3 - Requesting A Business

  • censoredcreampiehandjobHUNTBhuntermorikihhh groupHUNTB-134HUNTB134huntb00134
    • 2021-11-07
    38 min

    RURA-017 Moe (Pseudonym)

  • amateur censoreduniformamateurrurarura-017rura017rura-017
    • 2021-11-11
    203 min

    [NHDTB-596]A Video Of A Woman Who Was Married To A Senior Colleague And Had Her Sexually Axxaulted While On Duty.

  • censoredcreampiebig titsNHDTBnatural highsakurai baniraNHDTB-596NHDTB5961nhdtb00596
    • 2021-11-12
    162 min

    [JUFE-347]Men"s Nipple Specialist! Reona Tomiyasu"s Agonizingly Sensitive Clitoris Nipple Caressing Salon

  • takehiro tomiyasu censoredcreampiebig titsJUFEfitchJUFE-347JUFE347jufe00347
    • 2021-11-12
    151 min

    [MIAA-529]Ayaka Mochizuki Orgasmed So Hard She Almost Died After Being Fucked In 3 Holes At The Same Time By Middle-Aged Men...

  • ayaka mochizuki censoredcreampiesingle workMIAAmoodyztekiratei nominna no kikatanMIAA-529MIAA529miaa00529
    • 2021-11-13
    60 min

    [111321-001]Sex with my maid: she is my best sex partner

  • emi aoi uncensoredcreampiecaribbeancom
    • 2021-11-25
    117 min

    [SPRD-1488]Surrogate Mother Hana Haruna

  • haruna hana censoredcreampiemature womanSPRDtakara eizosanpei suminekoaleddinSPRD-1488SPRD148818sprd01488
    • 2021-12-03
    120 min

    [MIAA-538]She Hates Her Slovenly Boss, But She Couldn"t Turn Down His Relentless Titty Tweaking ... And He Gave This Female Employee A Compulsory Creampie While She Kept On Cumming As He Fondled Her Erect Nipples Misono Mizuhara

  • suwon miso censoredcreampiebig titsMIAAmoodyzhata tairyouminna no kikatanMIAA-538MIAA538miaa00538
    • 2021-12-14
    480 min

    [MUCH-142]8 Hours And 2 Discs Of Sex With 10 Women With Big Tits And Shaved Pussies

  • enomiya shiori tsukada censoredbig titsMUCHmothermuchimuchiMUCH-142MUCH142h-796much00142
    • 2021-12-28
    54 min

    498DDH-057 [Drink Karaoke With A Girl Friend! When I Approached With Drunken Momentum …] A Neat Girl Who Had Been Watching With Erotic Eyes For A Long Time, In Fact, Was Hungry For Ji ● Po! When I Show Off The Erected Thing, It Sucks With Glitte

  • amateur censoredcreampiesquirtingddhddh-057ddh057498ddh-057
    • 2021-12-30
    123 min

    [RD-1092]Showa Era Filthy And Sensual Drama. Married Woman Trying To Conceive Gets Fucked By A Hated Former Classmate That Used To Lift Her Skirt Up. Wife In Her Fifties Gives Herself Over Completely, Including Her Asshole, To Pay The Cost Of Her Deb

  • amateur censoredmarried womanblowjobRDatena eizouRD-1092RD1092
    • 2022-01-07
    175 min

    [NKKD-241]This is My Wife (33) Getting Fucked by My Part Time Employee (20, virgin) -> It was Hard on Me, so Please Release this AV as is. (Virgin Hunter Series).

  • censoredbig titsNKKDjet eizomanji groupNKKD-241NKKD241nkkd00241
    • 2022-01-08
    134 min

    [APAK-212]Horny S*****t With Beautiful Tits - This F-Cup Bangs The Cafe Manager At Her Part-Time Job! She Takes His Facial! Then His Creampie! Their Sex Videos Leaked Online! Rima Arai

  • lima arai censoredcreampieschoolgirlAPAKaurora project annexrkaurora project anexAPAK-212APAK212apak00212
    • 2022-01-13
    169 min

    [DRPT-003]The Sudden Emergence Of An Anal Monster With A Big Ass! With Her First Anal Fuck, You See The Whites Of Her Eyes As She Cums! Saya Minami.

  • minami saya censoredanalsingle workDRPTlemonheart nakajimaDRPT-003DRPT0031drpt00003
    • 2022-02-11
    184 min

    [SKMJ-255]Condom Breaks For Unbelievable Raw Fucking! Actual College Girl For A Real Pickup! First Orgasm Experience When She Gets Fucked So Hard And Fast That The Condom Breaks! Then She Gets Cum Loads Just Like That For Creampie Raw Footage!

  • censoredcreampieamateurSKMJred face girlone topSKMJ-255SKMJ255h-1324skmj00255
    • 2022-02-19
    241 min

    [MDBK-225]More Lewd Than Being Nude! Impressive Erotic 7 Transformations For Super Cute Girls! The Best Of Cosplay SEX!

  • hamazaki mao arisa hanyu arisu hanyu censoredcreampieMDBKbazookak taroMDBK-225MDBK225mdbk00225
    • 2022-02-28
    77 min

    522DHT-0431 Super Big Tits Tokyo Wife Moe 29 Years Old With A Glamorous Body Shape

  • amateur censoredcreampiebig titsdhtdht-0431dht0431522dht-0431
    • 2022-03-01
    71 min

    [MCSR-47001](Lewd Areola On F-Cup Tits) 3 Non-stop Rounds Of Creampie SEX! "I Get Wet So Easily" Met A Married Woman Online With An Amazing Figure And Top Tier Face (But She"s Super Lewd Looking).

  • censoredbig titsmarried womanMCSRbig mocalmuscatMCSR-47001MCSR4700157mcsr47001
    • 2022-03-05
    91 min

    [BAB-058]Host Crazy: An Outstanding Sales Account Leads To 3 Raw Creampies - Arisu Otsu

  • otsu alice censoredcreampiesingle workBABbabylon daydreamersBAB-058BAB058bab00058
    • 2022-03-11
    160 min

    [JJBK-053]Mature Woman Babes Only A Mature Woman Came To My Room, So I Took Her Home For A Peeping Good Time, And Sold The Footage As An Adult Video 51 This Horny Forty-Something Step Auntie Lusts For Her Step Nephew"s C*ck, The Stinkier The Bett

  • censoredmarried womanmature womanJJBKmature bank mature womangroupJJBK-053JJBK053jjbk00053
    • 2022-03-17
    80 min

    336KNB-198 [H Cup Married Woman And Adult Carnal Sex] Former Nurse’s President’s Wife Is Frustrated And Applies For Av! I Have To See The Huge Breasts H Cup Of Max With A Feeling Of Elasticity That I Can Not Think Of In My 40s! !! At Nakaga

  • amateur censoredbig titsmarried womanknbknb-198knb198336knb-198
    • 2022-03-18
    150 min

    [HMN-141]Half Russian Beautiful Girl With An Artistic Silk Body Is Now Permitted For A First-time Raw Creampie. Anna

  • anna censoredcreampiebeautiful girlHMNbookmamezawa mametaroHMN-141HMN141hmn00141
    • 2022-03-19
    134 min

    [GMEM-061]Bitchy Wife With A Lewd Tongue Gets A Transformative Realization To Turn Into A Sex Doll.

  • censoreddeepthroatbukkakeGMEMavs collector 039 sbuddha davscollector 039 s goldGMEM-061GMEM061gmem00061
    • 2020-06-19
    43 min

    FC2PPV 1409319 [Muchimuchi X Big Breasts] Muchimuchi Exquisite Body Hidden In Uniform [cen]

  • amateur uncensoredfc2
    • 2022-04-01
    120 min

    NNPJ-506 Met An Ordinary College Girl Via Social Media Who Ended Up Being A Nipple Pleasure Prodigy! This Lewd Girl Tightens Her Pussy In Pleasure While Those Pink Nipples Get Pinched! Lewd Titty Pleasure For Total Breaking In To Make Her Sensitive A

  • censoredcreampieNNPJnampa japanNNPJ-506NNPJ506nnpj00506
    • 2022-03-20
    31 min

    FC2PPV 2739483 [Complete Face Exposure] [Raw Squirrel To The Signboard Girl Of A Cake Shop In The Neighborhood] * Please Note That Early Sales Will End Due To Unauthorized Style Exhibition *

  • amateur uncensoredfc2
    • 2022-04-12
    92 min

    261ARA-534 [Super Cute] [Blonde Gal] Mio-Chan Is Here! She Recently Lacked "I Want To Charge My Sexual Desire! 』 I Want To Satisfy My Sexual Desire By Being Blamed With All My Strength! I’d Like To Get Sweaty W [Fair-Skinned Slender] [Vagina

  • amateur censoredamateuraraara-534ara534261ara-534



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored