censored high vision jav hours more planning




FC2GVHWAAAAUKGCESDHDKAAPODSQTEMIAAMILKSANAWDSHKDNATRPREDSPRDCHRVAUKGSSNIBBANWANZ

2021-01-02
39 min

361SEKAO-142 Bella Moretti from L.A

  • amateur censoredamateursekaosekao-142sekao142361sekao-142
    • 2021-01-05
    60 min

    10musume 010521_01 I longed to read the restraint play of porn books for the first time in junior high school UEMOTOYURI

  • amateur uncensored10musume
    • 2021-01-16
    61 min

    HEYZO 2441 After 6 -Playing With Her Beautiful Boin Boobs- – Miyu Morita

  • miyu morita uncensoredcreampiehandjobheyzo
    • 2021-01-22
    72 min

    FC2PPV 1654786 [Major company model] Leaked ● Hard raw acme SEX at a secret cosplay photo session. A narrow pussy is opened with a thick cock and acme died in a few minutes. Forced seeding as it is (leaked Gonzo data)

  • amateur uncensoredfc2
    • 2021-02-01
    71 min

    [HKHS-009]Picking Up Girls In Los Angeles: Nova (22 Years Old), A Girl With A Plump Body, Big Tits And A Big Ass, Who Loves Anal Sex

  • censoredcreampieamateurHKHShikara delusion grouphollywood saburoHKHS-009HKHS009hkhs00009
    • 2021-02-05
    242 min

    [SCR-264]Barely Legal Teens G*******ged By Grown Ups On Camera 4 Hours

  • censoredcreampiebeautiful girlSCRglay zs crimeSCR-264SCR26412scr00264
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-26
    49 min

    230ORETD-849 Natsu-san

  • amateur censoredcreampiemarried womanoretdoretd-849oretd849230oretd-849
    • 2021-03-11
    123 min

    [GS-378]Back-Arching Aphrodisiac Oil Massage Parlor Newly Opened Oil Massage Parlor For S********ls Who Want To Feel Like Women!

  • censoredGSsosoru x garconred ballGS-378GS3781gs00378
    • 2021-03-12
    115 min

    [BANK-032]A Busty Wife Hot Spring Resort Date A Bashful Young Wife With J-Cup Titties Miho 26 Years Old

  • censoredcreampiebig titsBANKmako banktake chanBANK-032BANK032h-1495bank00032
    • 2021-03-16
    52 min

    C0930 ki210316 Natsuko Hayasaka 18years old

  • amateur uncensoredc0930
    • 2021-03-18
    58 min

    FC2PPV 1730846 Big boobs world tremor! Miraculous I Cup Ubu Bishoujo First Leak [Limited Premier]

  • amateur uncensoredfc2
    • 2021-03-30
    58 min

    [490FAND4-2]あかり

  • amateur censoredamateurbeautiful girlfand4fand4-2fand42490fand4-2
    • 2021-04-02
    98 min

    [SHKD-940]Don't Touch My Step Sister, She's Mine! Rin Kira Aoi Kururugi

  • kira rin aoi kururugi censoreduniformsisterSHKDattackerskazuki kuryusharkSHKD-940SHKD940shkd00940
    • 2021-04-02
    122 min

    [NGOD-146]Wife Gets Fucked By Her Middle Aged Coworker In The Train Station Bathroom Miho Tono

  • miho tsuno censoredmature womansingle workNGODjet eizomanji groupNGOD-146NGOD146ngod00146
    • 2021-04-15
    240 min

    [NASH-496]Why Are You Teasing An Old Lady Like Me! (A Madam/A Maid/A Female Guest) A Mature Woman Who Had Forgotten What It Feels Like To Be A Lady Goes To A Hot Springs Resort On The Outskirts Of Town But When She's Faced With An Orgasmic Rock H

  • censoreddramaNASHpinknadeshikoNASH-496NASH496nash00496
    • 2021-04-17
    72 min

    300NTK-554 A miracle! !! Beautiful x cute quarter-rolling beautiful girl! !! We are proud of our whitening soft skin pink nipples and peach butt! !! Needless to say, the sensitivity is good. The owner of the squirting maco! !! Just a squirting profes

  • amateur censoredcreampiesquirtingntkntk-554ntk554300ntk-554
    • 2021-04-18
    82 min

    200GANA-2475 Seriously Nampa, first shot. 1623 Picking up a nursery teacher with a lovely smile on a holiday! Aim for SEX while listening to work and boyfriend’s croaker! God body of tall G cup! Excellent amiability and sensitivity! I guarantee

  • amateur censoredbig titsamateurganagana-2475gana2475200gana-2475
    • 2021-04-21
    55 min

    492JCHA-014 The first denma is a lie

  • amateur censoreduniformschoolgirljchajcha-014jcha014492jcha-014
    • 2021-04-23
    120 min

    [MIAA-425]Convulsion Pleasure With Sexy Oil Aggressively Licking Her Pussy After She Already Came AIKA

  • aika censoredbig titssquirtingMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-425MIAA425miaa00425
    • 2021-04-27
    143 min

    [JSTK-007]Exclusive Debut First Time Shoot For Pretty Straight Boy First Time Cross Dressing Mio

  • censoredanalamateurJSTKmercurycross dressing tokioJSTK-007JSTK007h-1133jstk00007
    • 2021-04-30
    228 min

    [FBCPV-003]A Working Woman Is Beautiful And Sexy! We Visited These Ladies At Their Workplaces And Gave Them A Sexy Part-Time Job 3 A Naniwa Takoyaki Girl Gets Busy With Perverted, To-The-Limit Outdoor Plays, While A Voluptuous Beautiful Dental Assist

  • yukina minamino arisa kotone censoredcreampiebig titsFBCPVarisebyte chan premiere ariseFBCPV-003FBCPV003h-1577fbcpv00003
    • 2021-05-01
    166 min

    [HUNTB-005]"Whose Titties Do You Like Better？" "Are You Saying You Can't Fuck Us？" We Were On A Business Trip And Staying At A Hot Spring Resort Inn, And My 2 Prim And Proper Big Tits Lady Bosses Decided To Let Loose And Flung Off

  • censoredcreampieHUNTBhuntervolvo nakanohhh groupHUNTB-005HUNTB005huntb00005
    • 2021-05-05
    56 min

    FC2PPV 1803102 GW limited 1000 yen discount ★ Regular price as soon as it runs out ★ I want you to do it again … Refrain from events one after another! !! I want you to see my cosplay and H body ★ Part 1

  • amateur uncensoredfc2
    • 2021-05-06
    60 min

    336KNB-153 A lewd young wife "Reika" who has a desire to "want to see SEX by others". Legs while being inserted Pink masturbation is apt! !! I will take a gonzo with this married woman from now on. 46 at Tsudanuma Station, Narashino C

  • amateur censoredmarried womanamateurknbknb-153knb153336knb-153
    • 2021-05-25
    58 min

    Pacopacomama 052521_481 Please insert your dick into my pussy! Yukari Ayaka

  • amateur uncensoredpacopacomama
    • 2021-05-29
    116 min

    [BIJN-200]The Documentary Orgasmic Basic Instinct-Baring Sex We're Going To Fuck The Shit Out Of This Tanned Seriously Fucked Up Pussy Gal During This Orgy REMI

  • remi censoredsingle workBIJNbijin majo emmanuelleBIJN-200BIJN200bijn00200
    • 2021-06-01
    166 min

    [DKWT-011]She's Got Such A Pretty Face, But A Jungle Of Pussy Hairs!! This Horny Wife Has Been Letting Her Pussy Hairs Grow Wild And Now She's Squirting In Insane Orgasmic Pleasure Saryu Usui 33 Years Old

  • sakisui censoredsquirtingblowjobDKWToffice k syoung wife.communicationDKWT-011DKWT01136dkwt00011
    • 2021-06-11
    65 min

    FC2PPV 1863914 A teenage girl, Shiho-chan with an overwhelming sense of transparency. She called to the hotel after school and finally succeeded in vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-06-12
    103 min

    [NSPS-998]Mature Moms 11 - A Stepson Taking The Place Of His Stepfather - Shuri Yamaguchi

  • yuri yamaguchi censoredmature womanmomNSPSnagae stylenagaeNSPS-998NSPS998nsps00998
    • 2021-06-15
    126 min

    [KTRA-301]Creampie For My Slender, Beautiful Stepsister Suzu Monami

  • monami bell censoredcreampiebeautiful girlKTRAk tribeKTRA-301KTRA301h-094ktra00301
    • 2021-06-17
    150 min

    [CMV-155]Ballerina Tied Up Tight With Rope Pretty Girl Has Her Pussy Relentlessly Played With Riri Momoka

  • peach scent censoredcosplaybdsmCMVcinemagicmarukatsuvixenCMV-155CMV155cmv00155
    • 2021-06-18
    44 min

    FC2PPV 1873223 [Individual shooting] Minami 19 years old Innocent and innocent beautiful girl! A plump body that can conceive a body even if it has a Ubu personality! Two consecutive vaginal cum shots with lust for an obedient super beautiful girl!

  • amateur uncensoredfc2
    • 2021-06-20
    125 min

    [NEWM-005]True/Family Fun With A 40-something Year Old Stepmom And Stepson Sumire Shiratori

  • shiratori shiratori censoredmature womanmomNEWMglobal media entertainmentkikujiro akabanenewmomNEWM-005NEWM005newm00005
    • 2021-07-06
    94 min

    261ARA-496 [Transcendence Gal] [Absolute Beauty] Hono-chan is here! The reason for her application, who works at a hair removal salon, is "I want you to see my beautiful body ♪" I applied to show off! ？？ [Enchanted slender BODY] A dynamite bo

  • amateur censoredbig titsamateuraraara-496ara496261ara-496
    • 2021-07-23
    60 min

    FC2PPV 1937641 * Limited Time 4980⇒2980pt ★ First Shot ☆ The Advent Of A Beautiful Girl! Beautiful Face ♥ Beautiful Breasts ♥ Beautiful Body Lara 20 Years Old ☆ Sensitive Nympho Pussy Rolls Up ♥ Agony In Raw Dick ♥ Continuous Cum Shot Inside The Vagi

  • amateur uncensoredfc2
    • 2021-07-30
    31 min

    481SACZ-053 Minami 1

  • amateur censoredamateurbdsmsaczsacz-053sacz053481sacz-053
    • 2021-08-03
    57 min

    422ION-0076 I Decided To Shoot Her At The Hotel When My Boyfriend Met On SNS That I Was Not Satisfied With In A Light Night! !!

  • amateur censoredamateurbeautiful girlionion-0076ion0076422ion-0076
    • 2021-08-09
    63 min

    SIRO-4601 [First Shot] [First Experience G Milk Fucking] [Indecent Eyes] A Nutritionist Who Has Both Cuteness And A Lewd Atmosphere. If You Get A Concentrated Attack On The Fruitful Breasts And Stir The Thickened Secret Part .. AV Application On The

  • amateur censoredbig titssquirtingsirosiro-4601siro4601siro-4601
    • 2021-08-17
    57 min

    Pacopacomama 081721_519 Picking Up Another Man’S Wife On The Street Manami Nakasugi

  • amateur uncensoredpacopacomama
    • 2021-08-29
    49 min

    229SCUTE-1125 Marina (24) S-Cute Squirting Love Black Hair Uniform Girl Sex

  • amateur censoredsquirtinguniformscutescute-1125scute1125229scute-1125
    • 2021-09-23
    45 min

    H0930 ki210923 Mika Tamura 32years old

  • amateur uncensoredh0930
    • 2021-10-06
    59 min

    541AKYB-006 Maho (23) SSS Class! G Cup Beauty ♪ ​​(Hono Wakamiya)

  • amateur censoredcreampiebig titsakybakyb-006akyb006541akyb-006
    • 2021-10-10
    74 min

    534IND-002 Uniform Gachi Beautiful Girl! !! Raw Iki Attitude Is Also Raw Ji ○ Ko And Intense Piss Vaginal Cum Shot Success Or Failure! !! A Large Amount Of Sperm Leaked From Raw Ikima ○ In The Second Round Of Vaginal Cum Shot Without Permission! !! T

  • amateur censoredcreampiebig titsindind-002ind002534ind-002
    • 2021-10-15
    149 min

    [EBOD-862]Adorable Girl With A Cute Haircut! This Cheerful Beauty From Hakata Has G-cup Tits. She"s Come To Tokyo From Fukuoka For Her E-BODY Deluxe Specialty AV Debut! Noa Tensei

  • ai tenharu censoredbig titsbeautiful girlEBODe bodyarashiyama michiruEBOD-862EBOD862ebod00862
    • 2021-10-18
    70 min

    [SOMX-001]Take Love on Night at Hot Springs That Was Kept Secret From My Parents. Fuck As Much As I Like With Horny Girlfriend Who Wants Me In The Bath And the Room. Arisu Mizushima

  • amateur censoredSOMXorustak softSOMX-001SOMX001
    • 2021-10-23
    59 min

    481SACZ-069 Airi 6

  • amateur censoredamateurbdsmsaczsacz-069sacz069481sacz-069
    • 2021-10-30
    129 min

    390JAC-113 [Superb Style x Super Super Kawa Bitch x Orgy Halloween Party] Happy Haro Dirty! Oss! Oiler Is Fuck O Lantern! !! Get 2 Sperm-Hungry Sexual Desire Ghosts! !! Smell The Chin Smell Of Oil And Bite It Sloppyly! W Geki Saddle And Explosive Tid

  • amateur censoredcreampiesquirtingjacjac-113jac113390jac-113
    • 2021-11-05
    292 min

    [HUNTB-141]I"m The Only Guy At My School And Spring Cleaning Here, It"s A Panty Shot Heaven! A Panty Shot To See Everywhere You Look! 2 - This Was a Girls" School Till I Showed Up Last Year, Now I"m The Only Guy Here!

  • censoredcreampieschoolgirlHUNTBhunterkonnyaku kannohhh groupHUNTB-141HUNTB141huntb00141
    • 2021-11-17
    57 min

    230OREC-936 Matsuda (Kokona Asakura)

  • amateur censoredcreampieamateurorecorec-936orec936230orec-936
    • 2021-11-25
    76 min

    200GANA-2593 Seriously Nampa, First Shot. 1720 "Women’s Erotic Theory That Has Been Abroad" It Was Really Erotic When I Gave It To A Woman Who Picked Up The Topic Of Full Throttle! Shaking Beautiful Breasts And Fleshly Ass! While Being S

  • amateur censoredsquirtingamateurganagana-2593gana2593200gana-2593
    • 2021-12-01
    158 min

    [DOKS-549]Flying Bitch AV Actresses" Sex Documentary #1: Ami Kashiwagi, A Pansexual College S*****t With An Insatiable Sex Drive

  • ami kashiwagi censoredlesbianslutDOKSoffice k somutsu sukebeiDOKS-549DOKS54936doks00549
    • 2021-12-04
    130 min

    [EMBZ-240]The Juicy, Wet, Horny Pantyhose Feet Of A Mature Married Woman

  • kazumi ikeya yumina hirosaki censoredmature womanEMBZjuku onna juku emmanuellejuku onna jukuEMBZ-240EMBZ240embz00240
    • 2021-12-07
    16 min

    FC2PPV 2493334 Fellatio Mouth Shot 4k Shooting (20 Years Old JD In The Car)

  • amateur uncensoredfc2
    • 2021-12-18
    71 min

    200GANA-2617 Seriously Nampa, First Shot. 1730 Picking Up An Erotic Woman Who Gets Fucked With A Guest At A Concafe! Extremely Narrow Paipanma ● The Sigh That Gradually Becomes Violent After Being Stabbed Is Erotic …

  • amateur censoredamateurganagana-2617gana2617200gana-2617
    • 2021-12-24
    123 min

    [DFE-057]I Am Eating Up This Y********l. Rena Usami

  • reina usami censoredcreampieuniformDFEwaap entertainmentnishiki sasafearlessDFE-057DFE0572dfe00057



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored