censored high vision planning orgy javcensored




FC2WAAAPREDMARAAUKGCJODMIDVHMNSSNISANKSBJABWSTARSSPRDMVSDSQTEADNCESDMIDEWANZNNPJ

2020-11-13
115 min

[DASD-757]Restarting An Erotic Part-time Job With A Superior I Respect And Admire. Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiebeautiful girlDASDdasrokusaburo mishimaDASD-757DASD757dasd00757
    • 2020-11-19
    140 min

    [HUNBL-021]Creampie Russian Roulette - Betraying Women -

  • censoredbeautiful girlHUNBLhunteraldebaranhhh groupHUNBL-021HUNBL021hunbl00021
    • 2020-11-21
    50 min

    H0930 ki201122 Fumiko Manaka 40years old

  • amateur uncensoredh0930
    • 2020-12-10
    124 min

    [FSDSS-133]Lovey-Dovey First-Time Furious Orgasms Piston-Pounding Sex Sara Kamiki

  • sara kamiki censoredbig titsbeautiful girlFSDSSfalenosatoshi maedafaleno starFSDSS-133FSDSS1331fsdss00133
    • 2020-12-24
    235 min

    [PIYO-099]She Only Offered Her Body In Order To Protect Her Loved Ones... But Now This Whale Of A Y********l Is Squirting Like A Horny Bitch And Excessively Cumming Like A Whore

  • censoredsquirtingschoolgirlPIYOhyokopiero dagrey wolfPIYO-099PIYO0991piyo00099
    • 2021-01-01

    10musume 010121_02 Never Ending Self Deep Throating Sanae Kiuchi

  • amateur uncensored10musume
    • 2021-01-15
    86 min

    [YMDS-013]A Delivery Gal! It's A SK**ls Challenge To See How Many Cum Shots She Can Fire Off! Ran Tsukishiro A Death Match To See How Many Cum Shots She Can Ejaculate!

  • ran tsukishiro censoredcreampiehandjobYMDSmomotaro video publishinghimrockyoung peachYMDS-013YMDS013ymds00013
    • 2021-01-15
    119 min

    [NASH-439]MILF In Her Fifties Ravished At Work

  • censoredbig titsmature womanNASHnadeshikoNASH-439NASH439h-067nash00439
    • 2021-01-16
    118 min

    [PPPD-898]My Girlfriend's Older Sister Tempted Me With Her Big Tits And Her Love Of Creampie Sex Nene Tanaka

  • nene tanaka censoredcreampiebig titsPPPDoppaiPPPD-898PPPD898pppd00898
    • 2021-01-19
    62 min

    HEYZO 2443 Orgasms With A Horny Pussy Girl Vol.11 – Kana Takashima

  • kana takashima uncensoredcreampieheyzo
    • 2021-01-23
    66 min

    476MLA-017 A department store clerk found in Ebisu awakens to an unexpected de М ☆ A dangerous guy who is vulgarly disturbed by sports girls with an intellectual atmosphere! !!

  • amateur censoredcreampiebig titsmlamla-017mla017476mla-017
    • 2021-01-23
    136 min

    [JUL-448]Gorgeous, Voluptuous Co-Stars! Your Sweaty Stepsisters Want To Share Their Colossal Tits With You And Take Your Creampie In A Three-Some Rin Okae Hana Haruna

  • rin okae haruna hana censoredcreampiebig titsJULmadonnamametaro mamezawaJUL-448JUL448jul00448
    • 2021-01-30
    84 min

    FC2PPV 1665156 [Celebration] ♀ 290 Female college student Sana-chan, 22 years old, 1st time Dirty little famous doujin AV model was retired with punishment gachinko impregnation! ~ Dangerous Day Authentic Creampie Fertilization Edition ~

  • amateur uncensoredfc2
    • 2021-02-17
    119 min

    435MFC-081 [Saddle and Gonzo] Gonzo with a beautiful body of Ero Riva of de S & de M! * Honoka / 23 years old / working at a cafe

  • amateur censoredcreampieamateurmfcmfc-081mfc081435mfc-081
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-25
    483 min

    [FCDSS-007]Ayaka Tomoda FALENO Her First Best Hits Collection 8 Hours 40 Cum Shots Of Super Tempting Semen Sucking Sex!! + Previously Unreleased POV Videos Of Real Sex

  • ayaka tomoda censoredslutsingle workFCDSSfalenofaleno starFCDSS-007FCDSS0071fcdss00007
    • 2021-03-27
    56 min

    230OREX-216 Ichika-chan

  • amateur censoredcreampieuniformorexorex-216orex216230orex-216
    • 2021-04-03
    148 min

    [FLAV-265]HYPER FETISH A Naughty Queen In A High-Cut Outfit Hot Bitches With Crazy Makeup And Voluptuous J-Cup Titties Are Rude And Crude Flesh Fantasy Sex Monsters Shuri Hazuki

  • hazuki shuri censoredslutsingle workFLAVdigital arkdigital ark digital arkFLAV-265FLAV265flav00265
    • 2021-04-10
    56 min

    FC2PPV 1763783 * Weekend limited 3980⇒2980pt ★ First shot amateur ☆ Super elastic G cup beauty big tits ♥ Muchi BODY Menhera Kanna-chan 18 years old ☆ Purpurun young body that can be played ♥ Despite being puzzled by the pervert play, she faints in a

  • amateur uncensoredfc2
    • 2021-04-24
    62 min

    H4610 ki210424 Rrquest

  • amateur uncensoredh4610
    • 2021-04-28
    61 min

    517MQXT-001 A Dirty Girl Who Has Convulsions By Playing With Shaved Secret Lips

  • amateur censoredschoolgirlamateurmqxtmqxt-001mqxt001517mqxt-001
    • 2021-05-01
    70 min

    [MBRAZ-029]川口彩夏 放課後、夕立…君と僕。

  • hanazawa himari censoredsoloworkMBRAZspice visualMBRAZ-029MBRAZ029
    • 2021-05-06
    59 min

    326HGP-023 Lewd Awakening Attacked By Drunk Sleeping ☆ E-Cup Indecent Woman Who Crazes Man’s Reason In Obscene Lingerie Cum Inside The Demon Piston! !!

  • amateur censoredcreampiebig titshgphgp-023hgp023326hgp-023
    • 2021-05-18
    60 min

    1Pondo 051821_001 My Best Friend’s Girl Friend : Yuka Ohashi

  • amateur uncensored1pondo
    • 2021-05-25
    403 min

    [STDDT-076](Special Set) Jerk Off Collection! Z Bondage Series Yuri Honma Ayumi Shinoda Rei Mizuna

  • really ayumi shinoda censoredmature womanSTDDTdogmanormal kimdogma discount setSTDDT-076STDDT076stddt00076
    • 2021-06-01
    140 min

    [TWT-037]She's Pissing In Her Bloomers!! Girls With Sensitive Pussies Who Piss Themselves With Orgasmic Pleasure Through The Big Vibrator Blame Game

  • censoredamateurTWTsarutoru video publishertwin tailsTWT-037TWT037h-897twt00037
    • 2021-06-04
    45 min

    520SSK-002 Aoi

  • amateur censoredcreampieuniformsskssk-002ssk002520ssk-002
    • 2021-06-05
    158 min

    [FLAV-271]HYPER FETISH A Naughty Queen In A High-Cut Outfit This Horny Gal Is A Rude And Crude Voluptuous Big Ass Maneater Who Loves To Serve Up Hospitality With Her Divine Blowjob Technique Miki Maeshima

  • miki maejima censoredslutsingle workFLAVdigital arkdigital ark digital arkFLAV-271FLAV271flav00271
    • 2021-06-19
    119 min

    [CAWD-232]Her 19-Year-Old Body's Still Developing - Ririi Sena - 2-Orgasm Special

  • lily sena censoredsquirtingbeautiful girlCAWDkawaiitake dCAWD-232CAWD232cawd00232
    • 2021-06-26
    85 min

    [DANDAN-001]She Can Never Say No! Nurse With H-Cup Tits Devotedly Services Her Patients With Titty Fucking Miss Yoshine

  • censoredbig titsblowjobDANDANdandytanaka baconDANDAN-001DANDAN0011dandan00001
    • 2021-07-01
    95 min

    [KCK-014]The Pet Male 14: Remodeled Into Female Form With Pierced Nipples. Satsuki.

  • censoredbdsmKCKsanwa publishingclick manKCK-014KCK014h-019kck00014
    • 2021-07-05
    82 min

    493NAEN-070 yen! ？？ Kansai dialect J ○ K raw vaginal cum shot! ？？ Sensitive busty girl who cums once a minute ○ Raw Ishihara Nozomi

  • amateur censoredamateurbeautiful girlnaennaen-070naen070493naen-070
    • 2021-07-27
    120 min

    [SAN-013]Bad Husband Makes His Wife Fuck His Own Boss Kanna Hirai

  • shiori hirai censoredcreampiesingle workSANmazaisland watakanomother mazaSAN-013SAN013h-796san00013
    • 2021-07-30
    117 min

    [PRED-332]先生の夜の顔。-優しいみなみ先生と、朝まで中出しセックスをして過ごした夜- 初川みなみ

  • hatsukawa minami censoredcreampieblowjobPREDpremiummaeda bungouelegancePRED-332PRED332pred00332
    • 2021-08-05
    41 min

    FC2PPV 1954766 1930pt → 930pt [Limited Delivery] Commit A Nice Married Woman With A Nice Ass With A Vaginal Cum Shot. Husband Is A Pilot And Former Ca Thoroughbred Couple’S Flight Event

  • amateur uncensoredfc2
    • 2021-08-07
    242 min

    [NASH-551]Fakecest - The Guilty Mother In Her 50s

  • kozue tokita reiko ayukawa censoredmature womanNASHnadeshikoNASH-551NASH551nash00551
    • 2021-08-13
    86 min

    HEYZO 2616 Loli Wifes Got Enemas, Anal Swapping -Married Couples, Miyazakis & Gotos- – Miyazaki&Goto Pearents

  • amateur uncensoredheyzo
    • 2021-09-03
    176 min

    [CAWD-272]This Real-Life College Girl Who Works At A Wholesome Massage Parlor Is A Pushover Who Can"t Refuse A Proposition, So She Decided To Give Her Customer A Handjob And Now Here She Is, Making Her Debut And Squeezing Out 8 Cum Shots For You

  • mitsuki okina censoredhandjobsingle workCAWDkawaiimamezawa mametarouCAWD-272CAWD272cawd00272
    • 2021-09-09
    40 min

    [IENFH-009]I Was Playing Pranks On My Big Stepsister That Night, But Then She Turned The Tables On Me And Fucked Me Raw, And I Was About To Cum, But Then She Locked Me Down With Her Legs And I Couldn"t Escape, So I Ended Up Creampie Cumming Insid

  • minami kozue censoredcreampieIENFHi energychrysanthemumienfIENFH-009IENFH0091ienfh00009
    • 2021-09-11
    60 min

    H4610 ki210912 Yua Hirasawa 25years old

  • amateur uncensoredh4610
    • 2021-09-15
    69 min

    FC2PPV 2207180 "By All Means, Only The Face …" The 18-Year-Old Slender Beauty Student Of 155 Cm Hides Her Face And Does Not Hide Her Pussy!

  • amateur uncensoredfc2
    • 2021-09-22
    65 min

    444KING-049 Meru

  • amateur censoredcreampiesquirtingkingking-049king049444king-049
    • 2021-10-01
    245 min

    [ZMAR-050]All Out! Hana Haruna 2

  • haruna hana censoredcreampiebig titsZMARplanet plusmaruttoZMAR-050ZMAR050h-237zmar00050
    • 2021-10-02
    61 min

    Caribbeancom 100221-001 The Luxury Adult Spa: Today My Pussy Belongs To You Misa Makise

  • misa makise uncensoredcreampiehandjobcaribbeancom
    • 2021-10-12
    57 min

    10musume 101221_01 Innocent College Girl Puts On Sexy Swimsuit Mai Sakurai

  • amateur uncensored10musume
    • 2021-10-16
    82 min

    FC2PPV 2351648 Saddle Tide Does Not Stop Intense Chewy Explosion Beautiful Girl! The Tide That Constantly Overflows From Sujiman Eventually Becomes Rain And Returns To The Ground. This Is The Water Planet, The Earth. [Ultra-Highest Quality Gonzo] Lim

  • amateur uncensoredfc2
    • 2021-10-16
    124 min

    [ZOCM-008]We"ll Deliver A Married Woman Slut To Your Door. Ai-san 29 Years Old Ai Kawana

  • ai kawana censoredcreampieslutZOCMzokuzoku musume mousouzokutodozokuzoku musumeZOCM-008ZOCM008zocm00008
    • 2021-10-17
    94 min

    300MAAN-708 <Because Of This Time, The Signboard Wife Of The Deficit Store And The Breast Butt Plump Tremor Sex! !! > That’S A Busty Wife Who Runs A Difficult-To-Manage Curry Shop! Serve Others By Mouth For The Shop! Atama Swallowed And Forc

  • amateur censoredcreampiebig titsmaanmaan-708maan708300maan-708
    • 2021-11-04
    122 min

    [MILK-124]The Hardcore Piston Fuck Of A Big Assed Lust Monster Blonde Horny Gal Hina Kawai

  • haruna kawai censoreduniformschoolgirlMILKmilkMILK-124MILK124h-1240milk00124
    • 2021-11-11
    62 min

    336KNB-180 [Female Face Of A Naive Amateur Wife] I Made A Woman With A Frustrated Married Woman Who Has Been Less Frustrated Since I Got Married W Pre-Buttocks & Cherry-Colored Nipples Are A Must-See! At Kazo Ekimae, Kazo City, Saitama Prefecture

  • amateur censoredmarried womanamateurknbknb-180knb180336knb-180
    • 2021-11-12
    168 min

    [MIDV-002]The Father-In-Law I Hated Fucked Me Mia Nanazawa

  • yuko hasegawa jun mihara censoredmature womanlingerieMIDVmoodyztakarase hironorimoodyz divaMIDV-002MIDV00248midv00002
    • 2021-11-12
    122 min

    [FOCS-033]Taken To A Hotel By A Perfect Slut In A Reverse Pick Up! Swallowing With A Full-Power Crazy Technique! A Cum Facial Splash From The Best Up-And-Down Meat Eating! Misuzu Kawana

  • misuzu kawana censoredblowjobslutFOCSabc mousou zokufocusFOCS-033FOCS033focs00033
    • 2021-11-12
    179 min

    [MVSD-487]I"ll Be Your Lover Until Graduation I Don"t Trust Women, But Rino-Sensei"s Healing Boobs Wrap Up My Heart And D*ck, Nasty, Close Slow Sex Yuki Rino

  • yuki rino censoredcreampiebig titsMVSDm s video groupms video groupMVSD-487MVSD487mvsd00487
    • 2021-12-08
    93 min

    [ETQR-321][Daydream POV] Keep Playing with the Nipples! A Slutty Beautiful Girl Visits you to Give Pleasure, Meru Ito

  • ito meru censoredcreampieuniformETQRerotic timeETQR-321ETQR321etqr00321
    • 2021-12-25
    106 min

    [ANX-140]Shin-hyou-girl #First Issue #Rear #With Boyfriend #Surveillance Ichiromahiro

  • mahiro ichiki censoredbeautiful girlsingle workANXsaimin kenkyuujo bekkanhypno mansaimin reijo saimin kenkyu bekkanANX-140ANX140anx00140
    • 2022-01-01
    127 min

    [KTKZ-093]"Who Are You？" A Super Beautiful Girl Who Made It The Final Round Of An Idol Group Audition Is Making Her Sensational And Vivid Virgin-Deflowering Debut! Yuka-chan

  • censoredamateurbeautiful girlKTKZkitixx mousouzokushinjinKTKZ-093KTKZ093ktkz00093



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored