censored hours more high vision amateur javcensored




FC2AMBIFSDSSBBANAUKGHODVPPPDHMNMVSDMARACAWDMIAAHNDHDKAWANZIPXMIDVJULSPRDPREDNACX

2020-09-16
240 min

[RVH-004]Anal Ballerina BEST vol. 1

  • nao hamasaki saya anjo censoredanalRVHglory questRVH-004RVH00413rvh00004
    • 2020-09-17
    83 min

    [AKDL-048]Perfect POV - Real Cock Rubbing 2

  • kohara kihara ami kirishima censoredbeautiful girlAKDLakinorishurikenaknrAKDL-048AKDL0481akdl00048
    • 2020-10-03
    59 min

    1Pondo 100320_001 Model Collection: Aya Eikura

  • amateur uncensored1pondo
    • 2020-10-08
    65 min

    FC2PPV 1527466 [Complete amateur 90] Marin 20 years old Part 3, complete appearance, anal training and bath play for F cup beautiful girl, 2 vaginal cum shot.

  • amateur uncensoredfc2
    • 2020-10-08
    266 min

    [VOV-064]A Massive Collection Of Gal Babes And Big Tits! A Nampa Seduction Chain Reaction Sex Party 04

  • censoredcreampiebig titsVOVit s thursday everyone gather upshake your hips as much as you wantVOV-064VOV064h-1350vov00064
    • 2020-10-22
    159 min

    [NTRD-083]Cuckolders: A Story About A Wife's Adultery With A Junior At The Company - Kanna Shinozaki

  • kina shinozaki censoredmature womansingle workNTRDtakara eizokouji takarashintokaiNTRD-083NTRD08318ntrd00083
    • 2020-11-01
    129 min

    [SQTE-335]Could You Let Me Suck Your Dick Just A Bit？ Kurumi Suzuhana

  • suzuka walnut censoredblowjobbeautiful girlSQTEs cuteSQTE-335SQTE335sqte00335
    • 2020-11-01
    153 min

    [DBER-087]Climax Fainting Convulsion Hell For A Strong Woman Roughly Fucked Until She Goes Crazy - RED BABE ULTRA MOVIES

  • censoredDBERbabyentertainmentred babeDBER-087DBER087dber00087
    • 2020-11-06
    119 min

    [JUL-369]My Very Own Cum Bucket!! An Obedient Married Woman Creampie Maid My Father-In-Law's Orders Demand Total Obedience I Spend My Days Receiving Breaking In Impregnation Fucks Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsJULmadonnarokusaburo mishimaJUL-369JUL369jul00369
    • 2020-11-12
    225 min

    [PIYO-094](For Streaming Editions Only, Cums With Bonus Footage) "Even If It's Us Against The World, I'll Always Protect You" Experience Days Of Crazed Love And Adultery, Filled With The Impregnations Of His S*****ts Through Creampie

  • censoredcreampieslutPIYOhyokopiero dabicchiPIYO-094PIYO0941piyo00094
    • 2020-11-27
    120 min

    [DAVK-061]Losing Her Virginity With An HB Pencil! Daydreaming Y********l School Graduate With Zero Real Experience Has Her First Dick Experience With Middle-Aged Man! [Opening Her Pussy Wide Outdoors In The Middle Of The Day] - [Powerfully Squirting

  • censoredcreampieDAVKtmadoujin av clubDAVK-061DAVK06155davk00061
    • 2020-12-10
    21 min

    FC2PPV 1601701 [No] I gave a vaginal cum shot at the age of 20 aiming for the title of a diploma

  • amateur uncensoredfc2
    • 2020-12-20
    138 min

    [DASD-784]This Big Tits Wife Was Susceptible To Suggestion And Although She Tried To Resist At First, She Has Now Become A Horny Bitch Kurea Hasumi Tsubasa Hachino

  • hasumi claire yano tsubasa censoredcreampiebig titsDASDdasrokusaburo mishimaDASD-784DASD784dasd00784
    • 2020-12-24
    198 min

    [NHDTB-476]French Kiss From Above, Slow Blowjob From Below - Dual Pronged Teasing From Slutty Stepsisters

  • censoredblowjobsisterNHDTBnatural highrafting maeshiroNHDTB-476NHDTB4761nhdtb00476
    • 2021-01-08
    62 min

    Pacopacomama 010821_416 Ayumi Tsuji

  • ayumi tsuji uncensoredcreampiebig titspacopacomama
    • 2021-01-14
    60 min

    Pacopacomama 011421_421 Ayano Shiraishi

  • amateur uncensoredcreampieblowjobpacopacomama
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-16
    232 min

    [HUNTA-931]"You Need To Peel Back Your Foreskin And Wash It Carefully, Okay？" 3 - My Older Stepsister Always Treats Me Like A K*d, Including Telling Me How To Take Care Of My Dick

  • censoredcreampiebig titsHUNTAhuntermorikihhh groupHUNTA-931HUNTA931hunta00931
    • 2021-01-30
    34 min

    FC2PPV 1664992 [Junior-kun ②] When I applied a junior from a sexual desire monster company and a baby-faced beautiful girl … It was more like copulation than naughty (laughs)

  • amateur uncensoredfc2
    • 2021-01-31
    149 min

    [DBER-098]Amazing Real Orgasms! Sweaty, Shaking CLIMAX SPECIAL RED BABE ULTRA MOVIES

  • censoredDBERbabyentertainmentred babeDBER-098DBER098dber00098
    • 2021-02-02
    63 min

    HEYZO 2451 Discrete Maid Is Ready For Naughty Care Vol.12 – Miyu Ono

  • miyu ono uncensoredcreampieheyzo
    • 2021-02-12
    162 min

    [MIDE-884]Abstinence Sensitive Pussy: Convulsions, Screaming Acme Squirting From Hard Piston Fuck - Mia Nanasawa

  • nanasawa mia censoredsquirtingbeautiful girlMIDEmoodyzzaku araimoodyz divaMIDE-884MIDE884mide00884
    • 2021-02-12
    129 min

    [ABW-056]Creampie: Fuck As Much As You Want 8 - Ako Shiraishi

  • akiko shiraishi censoredcreampiesingle workABWprestigeitoman akifumiabsolutely wonderfulABW-056ABW056118abw00056
    • 2021-02-13
    115 min

    [VENX-007]Whispered Temptation So Daddy Doesn't Hear - MILF Seduces Her Stepson Nao Nakano

  • nanao nakano censoredcreampiebig titsVENXvenuskanyeincestVENX-007VENX007venx00007
    • 2021-03-03
    120 min

    [PFES-020]She's So Naughty She's Nasty - We Found This Voluptuous Back Alley Slut And Secretly Fucked Her Full Of Raw Creampies All Day Long At A Love Hotel

  • censoredcreampiebig titsPFESkira kirasummer panties festivalPFES-020PFES020pfes00020
    • 2021-03-04
    150 min

    [C-2620]Please Steal My Wife (Asuka, Age 25) 92

  • censoredmarried womanCgogostakeshi karakicore gogo sC-2620C2620
    • 2021-03-19
    63 min

    [sika-053]みか(18)

  • amateur censoredschoolgirlamateursikasika-053sika053sika-053
    • 2021-03-27
    130 min

    [KNAM-037]Completely Raw STYLE @ Minami Young Lady From A School In Minato-ku S********l With F-Cup Tits Wants You To Cum In Her Minami Haruka

  • haruka minami censoredcreampiebig titsKNAMfirst star100 raw styleKNAM-037KNAM037h-491knam00037
    • 2021-04-08
    149 min

    [SPRD-1398]Surrogate Mother: Yuri Tadokoro

  • yuri tadokoro censoredmomsingle workSPRDtakara eizohotate ikkanaleddinSPRD-1398SPRD139818sprd01398
    • 2021-05-07
    184 min

    [SW-775]Do These 3 Intelligent Colossal Tits Sisters In Glasses Love Masturbation!？ When I Was Lured To Temptation With Their Excessively Erotic Body, My Dick Got Fully Rock Hard And They Started Scrubbing And Rubbing My Dick With Their Huge Tits And

  • censoredbig titssisterSWswitchcambridgeswitch switchSW-775SW7751sw00775
    • 2021-05-14
    125 min

    [ARM-978]Raunchy S********ls Masturbate While Showing Off Their Stained Wet Panties

  • otohana eve hazuki peach censoredschoolgirlARMaroma planningmania satoshiaromaARM-978ARM978arm00978
    • 2021-05-21
    55 min

    FC2PPV 1829554 * Weekend limited 6000⇒3980pt ★ Inverted nipple transcendental beauty BODY’s super cute Aimi-chan 19 years old ☆ Systemic erogenous zone ♥ Sensitive bristle pussy rolls up ♥ Excitement MAX super squirrel mass cum shot that perfect

  • amateur uncensoredfc2
    • 2021-06-04
    189 min

    [UMD-784]Everybody Would Want To Fuck Her From Behind If Their Are Shown Her Ass Like That...

  • jinguji temple nao sena ai censoredUMDleotabu osakiUMD-784UMD784125umd00784
    • 2021-06-16
    112 min

    300MIUM-711 [J Cup 116cm & Ji ● A long erotic tongue that entwines the whole thing] and knocks it down from morning till night! I played with rare big tits that I can hardly see!

  • amateur censoredbig titssquirtingmiummium-711mium711300mium-711
    • 2021-07-06
    58 min

    C0930 ki210706 Yoshino Sasahara 39years old

  • amateur uncensoredc0930
    • 2021-08-08
    282 min

    [ERHT-002]Hot POV Voyeur Porn Is The Best 2

  • censoredbig titsERHTariseflea market ariseERHT-002ERHT002h-1577erht00002
    • 2021-08-11
    64 min

    230OREC-845 Meru-San (26 Years Old) 2nd Year Of Marriage

  • amateur censoredcreampiebig titsorecorec-845orec845230orec-845
    • 2021-09-09
    104 min

    FC2PPV 2179701 Doll Half-Type 157 Cm 43 Kg Fair-Skinned Slender. "Is It Okay To Do Something Wrong With Her Teacher？"

  • amateur uncensoredfc2
    • 2021-09-17
    155 min

    [EYAN-174]Married For 1 Year / 22 Years Old / Ex Idol Video Model. Gorgeous Non-nude Erotica, Sexy Costume Non-Nude Erotica, Young Wife. The Limit Is Up For This Exhibitionist AV Debut Performance. F-cup Maika

  • censoredbig titsEYANe bodytorendei yamaguchihanazakari no tsumatachiEYAN-174EYAN174eyan00174
    • 2021-09-30
    101 min

    FC2PPV 2272808 [Individual Shooting 56] Complete Appearance 20 Years Old Legal Loli Pie Bread Serika ④ Cleaning Blowjob From Continuous Vaginal Cum Shot After Outdoor Exposure

  • amateur uncensoredfc2
    • 2021-10-23
    65 min

    H0930 tk0044 Manami Higaki 35years old

  • amateur uncensoredh0930
    • 2021-11-10
    107 min

    420POW-063 Monaka (Mitsuki Maya)

  • amateur censoredbig titsuniformpowpow-063pow063pow-063
    • 2021-11-11
    83 min

    [IENF-175]"Looks Like I Finally Managed To Get You Hard. I Always Get This Wet When I"m Turned On..." I grew Up With The Guy Next Door, So He"s Never Thought Of Me As A Girl, But A Flash Of My Panties Got Him Hard Today! I Let Him Tou

  • yui tenma tsugumi mizusawa censoredcreampieuniformIENFie nergytaiga kosakaiienfIENF-175IENF1751ienf00175
    • 2021-11-16
    59 min

    SIRO-4669 [First Shot] [Elegant Appearance] [Sigh That Leaks Indecently] Politeness ○ A Beautiful Tutor Who Has Both Wisdom And Bewitching Advent. The Intense Piston From Her Back Writhes Her Outstanding Style, And While She Has An Ecstatic Expressio

  • amateur censoredamateursirosiro-4669siro4669siro-4669
    • 2021-12-04
    59 min

    [120421-001]Luxury Adult Healing Spa: Nanako Asahina, Runa

  • amateur uncensoredcreampielesbiancaribbeancom
    • 2021-12-10
    180 min

    [IPX-775]Go To Beach! I Tried To Fuck An Amateur In A Reverse Pickup Wagon! Will You Ride With Me？ Anna Kami

  • anna kami censoredblowjobsingle workIPXidea pocketzampadishIPX-775IPX775ipx00775
    • 2021-12-17
    49 min

    230OREC-973 Juju (Juno Sakai)

  • amateur censoredcreampieschoolgirlorecorec-973orec973230orec-973
    • 2021-12-24
    118 min

    [HMN-098]The Intruder, The Wife Who Kept Asking Me About It, And The Kimeseki Impregnation Voice, Riho Fujimori

  • riho fujimori censoredcreampiebig titsHMNhon nakamametaro mamezawaHMN-098HMN098hmn00098
    • 2021-12-25
    58 min

    H4610 ki211226 Mai Sakura 27years old

  • amateur uncensoredh4610
    • 2022-01-20
    180 min

    [OFKU-196]団地妻のフェロモン肉体 欲情中出しSEX

  • rieko hiraoka yuki nanami censoredcreampieOFKUstar paradiseofukuro tetsudouOFKU-196OFKU196h-254ofku00196
    • 2022-01-27
    235 min

    [DOCP-342]予約半年待ちリピ率100 某メンズエステ店 密室×密着 イキ過ぎた禁断サービス ねっとり乳首責め編

  • amateur censoredcreampieamateurdocpdocp-342docp342docp-342
    • 2022-01-28
    119 min

    [ADN-374]I Found Out My Wife"s Sister Wants Me, So We Fucked Like Crazy Behind Her Back Starring Mako Iga

  • iga mako censoredcreampiebeautiful girlADNattackerskitorune kawaguchiotona no dramaADN-374ADN374adn00374
    • 2022-01-29
    139 min

    [PKPT-007]The 18-Year Old Girl Who Is OK With A Creampie While Engaged In Compensated Dating. With Her J-Cup Tits And MAXIMUM Sex Drive, She Jacks You Off For 5 Shots. Alice Kisaki.

  • kisaki alice censoredcreampiebig titsPKPTfuck group and fun friends daydreamersPKPT-007PKPT007pkpt00007
    • 2022-01-31
    45 min

    544IDJS-086 Mary (25) [Blonde Beauty] [Big Ass] [Creampie] (June Lovejoy)

  • amateur censoredcreampiebig titsidjsidjs-086idjs086544idjs-086
    • 2022-02-12
    50 min

    C0930 ki220212 Rie Momose 23years old

  • amateur uncensoredc0930
    • 2022-02-24
    92 min

    FC2PPV 2682233 [No Amateur Individual Shooting] A 22-Year-Old Nursery Teacher Who Loses His Place And Drinks On The Street After Work Picks Up A Big Tits Girl And Succeeds In Bringing It To The Hotel! While Suddenly Changing From M To S Or Being Toss

  • amateur uncensoredfc2



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored