censored humiliation schoolgirl javcensored school uniform




FC2JULHODVCAWDNACRAWDDASDMIDEAPODSANBLKNATRGMEMVEMAMILKFSDSSHMNHNDSQTEMIAAMEYD

2020-11-23
60 min

FC2PPV 1576023 [Personal shooting] [No] First shot! A girl with a cute smile and a small ass shaved pussy! You can download the main part high-quality ZIP, blowjob and masturbation (48 minutes) as a review privilege

  • amateur uncensoredfc2
    • 2020-12-03
    125 min

    [JURA-034]First Time In Her 50s: A Wife, Again. Mitsuyo Ikuno

  • mitsuyo ikuno censoredcreampiemarried womanJURAcenter villagesouthern earthjurakuJURA-034JURA034h-086jura00034
    • 2020-12-07
    83 min

    259LUXU-1349 Luxury TV 1336 Masturbation frequency twice daily! ？？ Is it the nature of the job of a nurse who has few encounters？ Pay attention to the appearance that the sexual desire that can not be resolved is disturbed only with Hara-san!

  • amateur censoredamateurluxuluxu-1349luxu1349259luxu-1349
    • 2020-12-25
    55 min

    FC2PPV 1619604 [Ends as soon as 30 OFF is gone] Two of the strongest beautiful girls in history will double perform as Santa on a holy night! !! As a result, it will be amazing ❤ With sequel benefits

  • amateur uncensoredfc2
    • 2021-01-01
    134 min

    [EKDV-652]Natsu Tojo Makes Males Subs Cum Buckets! These Desperate Guys Plead To Get Off And Natsu Makes Their Dreams Cum True!

  • natsu tojo censoredcreampiesquirtingEKDVcrystal picturekintaro okumae kissEKDV-652EKDV65249ekdv00652
    • 2021-01-08
    25 min

    FC2PPV 1637395 [Individual shooting] Secretly to my husband … An affair wife who becomes a captive of another stick for the first time in a long time. .. ..

  • amateur uncensoredfc2
    • 2021-01-12
    485 min

    [KTRA-271]Stepfather And Daughter Family Fun - Immoral Meat Stick Breaking In, 8 Hours, 4-disc BOX

  • mie yazawa wato heart censoredcreampieschoolgirlKTRAk tribeKTRA-271KTRA271h-094ktra00271
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-22
    78 min

    300MAAN-619 [Gentle local beauty JD / Iki tide! Saddle tide! Arashi / 4 shots of the whole body] At first glance I thought it was a normal JD who came to sightseeing from Miyagi … It was a perverted libido monster that loves sperm, denma, and bi

  • amateur censoredcreampiesquirtingmaanmaan-619maan619300maan-619
    • 2021-01-24
    141 min

    [QRDA-122]Beautiful Legs - Long-Legged Mistress Teases You Sara

  • censoredQRDAqueen roadQRDA-122QRDA122qrda00122
    • 2021-02-06
    19 min

    FC2PPV 1675096 [3P Raw Creampie Real NTR] A married woman who tries to make lightly pickled cucumber for tonight’s husband’s side dish

  • amateur uncensoredfc2
    • 2021-02-12
    141 min

    [FONE-134]She Needed The Cash: Tall, Busty Model With An Hourglass Figure - This College Girl Looks Barely Legal.

  • censoredcreampiebig titsFONEfirstplusFONE-134FONE134h-491fone00134
    • 2021-02-20
    65 min

    324SRTD-0210 If you teach big breasts with a cute smile a different dimension of pleasure, you will be in a situation where “Dangerous! Impossible!”

  • amateur censoredbig titsamateursrtdsrtd-0210srtd0210324srtd-0210
    • 2021-03-03
    70 min

    [ion-079]真琴(29)

  • amateur censoredbig titsamateurionion-079ion079ion-079
    • 2021-03-13
    117 min

    [MIDE-895]A Female Teacher Is Held In Confinement This S*****t Loves Rough Sex And Now He's Got A Plan To Transform Her Into His Own Free-For-All Fuck Hole Rei Futami

  • rei futami censoredsquirtingsingle workMIDEmoodyzdragon nishikawamoodyz divaMIDE-895MIDE895mide00895
    • 2021-03-19
    244 min

    [TUS-094]120 Real Aggressive Flirting Legends Vol 94 Flirting In Nampa! Huge Success With Loads Of Horny Girls!

  • censoredcreampiebig titsTUSprestigefishermanTUS-094TUS094118tus00094
    • 2021-04-02
    186 min

    [HUNTA-977]Monthly All You Can Fuck Program! As Long As You Pay A Monthly Fee You Can Fuck Any Of The Female Employees And Receptionists! 2

  • censoreduniformHUNTAhunterkorosukehhh groupHUNTA-977HUNTA977hunta00977
    • 2021-04-10
    106 min

    [NSPS-983]Home For Three Days. Bride Turned Into Her Father-In-Law's Sex Pet. Kanon Nakajo

  • nakajo canon censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-983NSPS983nsps00983
    • 2021-04-16
    115 min

    [PARATHD-3147]I Will Do Anything To Fuck My Mom's Friend With A Bangin Booty (6)

  • censoredmarried womanamateurPARATHDparadise tvPARATHD-3147PARATHD3147parathd03147
    • 2021-04-29
    488 min

    [CVDX-445]Slurping, Sucking Female Vaginal Suction Power! You Get To Suck On A Mature Woman's Clit And Cum Until You Can Cum No More In This Creampie Sex Paradise 40 Ladies 8 Hours 2-Disc Set

  • censoredcreampiemature womanCVDXcenter villageCVDX-445CVDX445h-086cvdx00445
    • 2021-05-01
    115 min

    [RBK-012]The Tragic Super High-Class Raw Sex Soapland Lady Michiru Kyujo

  • kujo michiru censoredsingle workRBKattackerseitaro hagaeryupakuRBK-012RBK012rbk00012
    • 2021-05-14
    141 min

    [ROYD-056]The Dorm Mom's Daughter Was Completely Defenseless When She Came In To Help With The Sex-starved Male Dorm. Airi Momose

  • momose airi censoredcreampieschoolgirlROYDroyalkoichi davidsonhhh groupROYD-056ROYD056royd00056
    • 2021-05-14
    120 min

    [BLK-499]"I Can't Believe This... I Haven't Touched Myself In Ages, I'm So Wet" Desperately Horny Gal Has Her Boyfriend Cancel Their Date At The Last Minute! She's Pissed Off At Him And Ready To Cheat - Fucking A Gorgeous Gir

  • censoredcreampiebig titsBLKkira kirakira kira black galBLK-499BLK499blk00499
    • 2021-05-19
    50 min

    [051921-001][VR] Sex with nurse cosplay

  • emiri momota uncensoredcreampiecaribbeancom
    • 2021-05-20
    88 min

    [YOZ-386]Gorgeous Call Girl Delivered To Your Door 2

  • censoredbig titslingerieYOZstar paradiseyaozokuYOZ-386YOZ386h-254yoz00386
    • 2021-05-21
    88 min

    277DCV-182 Is it okay to send it home？ case.176 [Twisting & Climax SP] Prima on the ice! Former figure skater is the current gal! It ’s good to be strong! Climax free program ⇒ Give up the Olympics and go to a spear man gal ⇒ I can not move becaus

  • amateur censoredamateurdcvdcv-182dcv182277dcv-182
    • 2021-05-21
    34 min

    359TYVM-158 Pinch and eat the entry / exit trader! Creampie sex with a squirting wife who works at a famous department store! !!

  • amateur censoredcreampiemarried womantyvmtyvm-158tyvm158359tyvm-158
    • 2021-06-03
    103 min

    [AKDL-113][Loving Armpits] My Older Brother Loves My Armpits - Aina Hayashi

  • aina hayashi censoredbeautiful girlsisterAKDLaquinoriaquinoriaknrAKDL-113AKDL1131akdl00113
    • 2021-06-10
    121 min

    [DLDSS-011]Beautiful Door-to-Door Insurance Saleswoman's Sexual Favors Trade Her Secret Technique That Gives Her 100 Success Rate Of Securing Contracts Ayaka Tomoda

  • ayaka tomoda censoredcreampiesingle workDLDSSdahliapassionate employeeDLDSS-011DLDSS0111dldss00011
    • 2021-06-20
    135 min

    [OPPW-097]French Kiss SOAP Sora Shinohara

  • sora shinohara censoredanalsingle workOPPWopenipeni world mousouzokuhimu lockOPPW-097OPPW097oppw00097
    • 2021-06-25
    80 min

    259LUXU-1438 Luxury TV 1422 Any man will love it! An active graduate student model with a tall and beautiful face appears again! Don’t miss the too beautiful standing back that tastes the small devil technique that captivates a man and the wild

  • amateur censoredamateurluxuluxu-1438luxu1438259luxu-1438
    • 2021-06-29
    53 min

    C0930 ki210629 Sachie Hasegawa 47years old

  • amateur uncensoredc0930
    • 2021-07-02
    173 min

    [NKKD-215]Shameful Community Center Seduction My Wife Was Getting Fucked By The Men On The Neighborhood Association Every Thursday At The Community Center Reiko Kobayakawa

  • kobayakawa reiko censoredcreampiebig titsNKKDjet eizoNKKD-215NKKD215nkkd00215
    • 2021-07-03
    54 min

    H0930 ki210703 Michiyo Nozaki 37years old

  • amateur uncensoredh0930
    • 2021-07-03
    116 min

    [CMF-062]The Chrysanthemum Gate: A College Girl Who Turns Into A Masochistic Piece Of Livestock: Getting Fucked BY Beasts Over And Over Again - Chisato Mori

  • chisato mori censoredsingle workCMFcinemagicdirty kudoninhuCMF-062CMF062cmf00062
    • 2021-07-18
    127 min

    [GENM-085]Temptation Into SEX With Extreme Piston Action! The Man She Seduced Can Seriously Thrust His Hips - Mari Takasugi

  • mari takasugi censoredsingle workGENMgenekig 3GENM-085GENM085genm00085
    • 2021-07-27
    245 min

    [SDJS-123]SOD Female Employees Fan Appreciation Festival - New Hire Bus Tour! 2021 - Is It OK To Cum That Much？ A Total Of 111 Amazing Orgasms In All! Ultra-Refreshing Sex With 12 Smoking Hot Girls For A Luxurious 4 Hours - Feel Free To Bust Your Nut

  • kaede shimizu kotomi shino censoredamateurSDJSsod createSDJS-123SDJS123
    • 2021-08-20
    173 min

    [JUL-677]For This Moment And Forever: A Beautiful, Gentle Wife. Madonna-Type Big Rookie Minami Yasu, 28 Years Old AV Debut

  • minami ahn censoredmature womansingle workJULmadonnamamezawa mametarouJUL-677JUL677jul00677
    • 2021-08-26
    131 min

    [SPRD-1449]Journey: Just A Mother And Her Stepson - Aoi Yurika

  • yurika censoredmature womanmomSPRDtakara eizoumishima rokusaburoaleddinSPRD-1449SPRD144918sprd01449
    • 2021-09-01
    55 min

    FC2PPV 2118996 [Slender Gymnastics Girls] Cuteness 1000 ♥ (21 Years Old) A Handsome Boyfriend And A Zokkon Soft Body Lady Although It Is Embarrassing, The Pussy Is Taken And Squirting Acme Love Love Convulsions Cum Shot Personal Shooting [Careful Han

  • amateur uncensoredfc2
    • 2021-09-04
    49 min

    H0930 ki210904 Kana Takanashi 32years old

  • amateur uncensoredh0930
    • 2021-09-07
    67 min

    FC2PPV 2172477 * Limited Time Price Until 9/13 [2480pt⇒1980pt] Loli Face Big Milk ★ H Cup Female College Student (19) ★ Love Love Squirting Sex With Older Boyfriend [4k Benefits Available]

  • amateur uncensoredfc2
    • 2021-09-30
    121 min

    [JRZE-079]First Time Filming My Affair - Fumina Kaji

  • fina kaji censoredcreampiemature womanJRZEcenter villageminami daichishoku ureJRZE-079JRZE079h-086jrze00079
    • 2021-10-01
    51 min

    491TKWA-195 Big Tits Gal J ● And Raw Creampie! (Takehiro Tomiyasu)

  • amateur censoredcreampieuniformtkwatkwa-195tkwa195491tkwa-195
    • 2021-10-20
    121 min

    [KIR-046]Cuckolded Big Tits Wife Creampie

  • maki kyoko mayu satomi censoredcreampiebig titsKIRstar paradisekirei star paradiseKIR-046KIR046h-254kir00046
    • 2021-11-11
    131 min

    [RCTD-431]Deep Kiss Dental Clinic 5 Yumi Saeki , Dr. Ka"s Anaconda Kiss SP

  • yuka saeki censoredslutsingle workRCTDrocketkambe tarouRCTD-431RCTD4311rctd00431
    • 2021-12-14
    142 min

    1Pondo 121421_001 Special Edition Emi Sakurai Emi Sakurai

  • amateur uncensored1pondo
    • 2021-12-18
    121 min

    [GVH-336]Father-in-law And Wife, Close Nakadashi Copulation, Shinon Mizutani

  • mizutani heart sound rio fujisaki censoredcreampiesingle workGVHglory questtakahashi chitsujiGVH-336GVH336gvh00336
    • 2021-12-21
    99 min

    300MAAN-730 [Over 300 Experienced People! Numb To The Chin Blame Tech Of A Shaved Gal] Former Yang Gal In Special Attack Clothes Appeared! ？？ "Sex Is A Sport ♪" A Local Man Is A Super Spear Man Who Devoured Her And Her AV Actor Is Also Tajita

  • amateur censoredcreampieamateurmaanmaan-730maan730300maan-730
    • 2021-12-27
    53 min

    [ETQR-328](Daydream POV) Loose Socks On This Slut. Temptation From A Beautiful Girl. SEX MIZUKI.

  • censoredcreampieuniformETQRerotic timeETQR-328ETQR328etqr00328
    • 2021-12-30
    21 min

    [HEYZO-2686]Akari Asagiri Erotic Massage for Akari

  • akari asagiri uncensoredcumshotheyzo
    • 2021-12-31
    119 min

    [MIAA-555]I Got An Erection When I Saw My C***dhood Friend Who Helps Me Being Fucked By A Bully Luna Tsukino

  • tsukino luna censoredcreampieschoolgirlMIAAmoodyzzack araiminna no kikatanMIAA-555MIAA555miaa00555
    • 2021-12-31
    119 min

    [RBK-032]For Money, I Married An Unfamiliar Rich Middle-Aged Sleazebag Of A Guy. Mako Iga

  • iga mako censoredcreampiebeautiful girlRBKattackersmekon echiryupakuRBK-032RBK032rbk00032
    • 2022-01-07
    143 min

    [JUL-827]The Married Woman Whose Husband"s Boss Adorns Her With Body Accessories Maki Hojo

  • hojo asahi censoredsingle workJULmadonnasatsugu koyamaJUL-827JUL827jul00827
    • 2022-01-29
    21 min

    FC2PPV 2632957 [Individual] Kyushu’s Thirty Wife. It Is Violated By Collateral And Drowns In Pleasure … It Is Vaginal Cum Shot With Two Strangers Sticks In The Bristle Vagina.

  • amateur uncensoredfc2
    • 2022-02-03
    129 min

    [FANH-064]Yumeri-chan, A College Girl With A Shapely Ass And Beautiful Tits To Take Advantage Of. Cheating On Her Boyfriend As She Gets Fucked Hard. Staring Hard During Agonizing Orgasms While Taking 2 Highly Fertile Creampie Loads.

  • censoredcreampiesquirtingFANHhamedori.network secondeditionFANH-064FANH064h-1472fanh00064



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored