censored jav big tits swimsuits javcensored




FC2SANHODVNACXHMNCHRVNACRSHKDVEMAPREDGVHAVSAFSDSSMILKDTTSSNIKSBJROYDNATRCESDDASD

2020-12-04
88 min

[SS-008]Magic Time - Ruka Inaba

  • censoredbig titsSSplumSS-008SS00813ss00008
    • 2020-12-13
    108 min

    [VEC-457]Married Woman Next Door Arouses Me, A Cherry Boy, With Her Front Hook Bra And Small Panties Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsVECvenuspetermegami venusVEC-457VEC457vec00457
    • 2020-12-17
    152 min

    [SSNI-949]155 Intense Orgasms! 5800 Spasms! 2000 cc Of Cum! Marshmellow G-Cup Mahina Amane's Erotic Awakening - Her First Extreme Climaxes Special

  • amane mahina censoredbig titssquirtingSSNIs1 no 1 styleusa pyonSSNI-949SSNI949ssni00949
    • 2020-12-18
    120 min

    [BKD-253]Stepmom/Stepson Sex (The Road To Mt. Chausu) Ryo Fukutomi

  • ryo fukutomi censoredmature womansingle workBKDrubykoji tsujitobijiBKD-253BKD253bkd00253
    • 2020-12-25
    239 min

    [YTR-150]Kotone Toa - Total Coverage - 4 Hours Of Fucking

  • toua kotone censoredcreampiedeepthroatYTRnonYTR-150YTR150h-127ytr00150
    • 2021-01-01
    134 min

    [EKDV-652]Natsu Tojo Makes Males Subs Cum Buckets! These Desperate Guys Plead To Get Off And Natsu Makes Their Dreams Cum True!

  • natsu tojo censoredcreampiesquirtingEKDVcrystal picturekintaro okumae kissEKDV-652EKDV65249ekdv00652
    • 2021-01-08
    86 min

    380SQB-083 Koharu

  • amateur censoredamateurblowjobsqbsqb-083sqb083sqb-083
    • 2021-01-16
    59 min

    10musume 011621_01 Not Wearing Make up Amateur : Look At My No Makeup Ordinary Face Masako Sawamura

  • amateur uncensored10musume
    • 2021-01-21
    178 min

    [AKDL-080]Meet An Amateur We Met On Thursday 1 (She's Revealing Her Face/She Works At A Massage Parlor/She's A Married Woman/NTR/POV/Beautiful Tits/Sex During Work)

  • censoredmarried womanamateurAKDLaquinoriaquinoriaknrAKDL-080AKDL0801akdl00080
    • 2021-02-04
    150 min

    [NITR-505]Pervert`s Hunt For Married Woman With Big Tits VII Nene Tanaka

  • nene tanaka censoredcreampiebig titsNITRcrystal eizoharuo miyafujinitroNITR-505NITR50549nitr00505
    • 2021-02-05
    122 min

    [UMD-766]Perverted Gynecologist!! 12 A Young Wife Who Doesn't Know Anything Gets A Creampie Instead Of Treatment!!

  • nene tanaka rumi tadami censoredbig titssquirtingUMDleodragon nishikawaUMD-766UMD766125umd00766
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    57 min

    328HMDN-336 Demon Cock x Married Woman] Child-rearing mom 32 years old Ryoko-san (pseudonym) Child-bearing wife again! Breastfeeding experience is the best! Seeding SEX that makes a frustrated pussy that is pleased with a dick after a long absence an

  • amateur censoredcreampiemarried womanhmdnhmdn-336hmdn336328hmdn-336
    • 2021-02-19
    153 min

    [MMKS-012]A Soapland Princess Who Gives You A Mean Service And Heals You With Her Massive Ass - Monami Takarada

  • takarada monami censoredbig titsMMKSmarrionkojiro miyamotoirisMMKS-012MMKS012mmks00012
    • 2021-02-21
    116 min

    [CJOD-282]"I Told You I've Already Ejaculated!" The Soapland Of Agony Unlimited Creampie Ejaculations! Follow-Up Man-Squirting! An Orgasmic Full Course Of Erotic Semen-Squeezing Yukino Nagisa

  • yukino nagi censoredcreampiebig titsCJODchijo heavenhirokoji osakiCJOD-282CJOD282cjod00282
    • 2021-02-21
    142 min

    [JUL-476]This Super Sweaty Married Woman Is Powerfully Shaking Her Ass So Hard, I Ended Up Creampie Fucking Her Without Ever Moving My Hips. Yuka Mizuno

  • yuka mizuno censoredcreampiemature womanJULmadonnasatsugu koyamaJUL-476JUL476jul00476
    • 2021-02-22
    62 min

    FC2PPV 1697042 [No] [Limited to 100 pieces 2980 → 1480pt OFF!] 20-year-old student, second sex in life, F cup pure girl ♥ ️ ice cream shop part-time job ♥ ️ Massive vaginal cum shot! !! ♥ ️

  • amateur uncensoredfc2
    • 2021-02-23
    119 min

    [STARS-331]A Sex-Crazed Married Woman Who Wants To Be Fucked She Was Tired Of The Same Boring Sex, So She Lured Another Man To Temptation And Brought Her Maso Perverted Desires So She Could Get Fucked Out Of Her Mind Mana Sakura

  • mana sakura censoredbig titsslutSTARSsod createinugami ryosod starSTARS-331STARS3311stars00331
    • 2021-03-07
    181 min

    [YMDD-222]First Time Shots An Amateur Documentary - We're Not Letting This 3-Star Amateur Get Away -

  • censoredcreampieamateurYMDDmomotaro eizoasakusa ga jirowakamomoYMDD-222YMDD222ymdd00222
    • 2021-03-16
    50 min

    H0930 ki210316 Ryoko oe 40years old

  • amateur uncensoredh0930
    • 2021-03-18
    183 min

    [ROYD-045]My Colleague From My Part-Time Job Missed Her Last Train Home, So She Came Over To My Place. We Were Just Going To Hang Out, But We Ended Up Fucking Until The Break Of Dawn, And It Was The Greatest Fuck Of My Life, And After That, To My Sur

  • yukine amazawa censoredcreampiesingle workROYDroyalspace nyanjirohhh groupROYD-045ROYD045royd00045
    • 2021-03-18
    119 min

    [TPPN-187]Big Titty Amateur Big Plump Tits On Display Groping Squeezing And Sucking Festival

  • censoredbig titsamateurTPPNteppanTPPN-187TPPN187tppn00187
    • 2021-03-27
    56 min

    230OREX-212 Ayase (H Cup)

  • amateur censoredcreampiebig titsorexorex-212orex212230orex-212
    • 2021-04-03
    104 min

    FC2PPV 1752327 Celebration! The 4th thank-you project for a cumulative total of over 20,000! [No individual shooting, outflow, young lady Gachi Beautiful girl NO. Who was sold by the dark route without being asked anything. 3] I’ll just say that

  • amateur uncensoredfc2
    • 2021-04-15
    124 min

    [GIGL-646]It's been five years since I graduated from a lower-level school back home and moved to Tokyo, and yet even though I'm a permanent part-time jobber, women want a piece of me!？ Women my age don't want me in the slightest, but tha

  • censoredcreampiebig titsGIGLgigoloGIGL-646GIGL646gigl00646
    • 2021-04-17
    237 min

    [HNDB-190]Total Slut Wants To Drain Your Balls Dry - BEST Collection - Infinite Creampies For Your Hard Cock - All 34 Loads!

  • censoredcreampieslutHNDBhon nakaHNDB-190HNDB190hndb00190
    • 2021-05-01
    150 min

    [SHKD-942]Cut Up And Ravaged! Beautiful Office Worker Targeted By The Scissor Man Miki Maeshima

  • miki maejima censoredsingle workSHKDattackerskazumasharkSHKD-942SHKD942shkd00942
    • 2021-05-01
    164 min

    [DOKS-542]Beautiful Y********l In School Uniform With A Hairy Pussy Urara Kanon

  • hanaoto urara censoreduniformschoolgirlDOKSoffice k sgonzaburo onigawaraDOKS-542DOKS54236doks00542
    • 2021-05-05
    133 min

    [GVH-227]Dual Anal Sluts 8 - Rui Hizuki / Hana Kano

  • rui hizuki kanna flower censoredslutGVHglory questtorindoru tanakaGVH-227GVH22713gvh00227
    • 2021-05-07
    60 min

    230OREC-757 Melo

  • amateur censoredcreampieamateurorecorec-757orec757230orec-757
    • 2021-05-08
    59 min

    FC2PPV 1807595 [Black 3P x NTR x personal photography] Welcome to the newlyweds! A 22-year-old gal new wife is seldom inserted into the strongest black tag in front of her husband and is taken down and cum shot 4 times in a row! Insert up to the fath

  • amateur uncensoredfc2
    • 2021-06-04
    162 min

    [JUL-601]"Hey, Are You Really A Virgin？" ~ Married Woman Is Made To Cum Over And Over By The Virgin Conman ~ Iori Nanase

  • iori nanase censoredbig titsmature womanJULmadonnajotaro tomiJUL-601JUL601jul00601
    • 2021-06-12
    130 min

    [DPMI-059]Unreal Panty Hose Legs: Miyabi Midorikawa

  • midorikawa miyabi censoredsingle workDPMImiludopamixDPMI-059DPMI059dpmi00059
    • 2021-06-13
    30 min

    FC2PPV 1867466 [Addition! Youth orgy] 2nd grade ♂♀ 4 people, adolescent bunny with continuous vaginal cum shot! Complete bitch of dick madness! I’m looking forward to the future w [I’m looking forward to the future]

  • amateur uncensoredfc2
    • 2021-06-16
    118 min

    [SSIS-092]Furious Pounded From A Huge Dick Drives Pussies Insane With Ecstasy - Intense Vaginal Orgasm Creampie SEX Ichika Hoshimiya

  • ichika hoshimiya censoredsquirtingsingle workSSISs1 no 1 styleichigoharaSSIS-092SSIS092ssis00092
    • 2021-06-19
    59 min

    HEYZO 2550 Toying With Sweaty Hot Chick! – Miyu Morita

  • miyu morita uncensoredcreampiehandjobheyzo
    • 2021-07-23
    128 min

    [JJCC-006]An Unfaithful Wife Who Wants Sperm - Takako

  • censoredcreampiebig titsJJCCjukujo japanJJCC-006JJCC006jjcc00006
    • 2021-08-07
    125 min

    [REAL-774]"I"m Going To Send You Straight Down To Sweet Hell" A Sweetly Sadistic Beautiful Girl Is Explosively Sucking Out Boys" Semen Until They Go Insane! Endless Insanity And Sweet And Squishy Pussy-Pounding Sex! Hana Shirato

  • white peach censoredcreampieblowjobREALk m producesamoarireal real worksREAL-774REAL774real00774
    • 2021-09-03
    255 min

    [DVDMS-706]Faces Revealed On The Magic Mirror Number Bus Beautiful Married Woman Babes Only The Magic Mirror Number Bus A Neat And Clean Housewife Is Leaving Her Pantyhose On For The First Time As She Experiences Squirting Ecstasy! 3 She"s Gettin

  • censoredmarried womansquirtingDVDMSdeepsking of genkingthe magic mirror mm mm flightsDVDMS-706DVDMS706dvdms00706
    • 2021-09-07
    194 min

    [SDAB-193]青春美少女がデカチン絶頂 バナナサイズの巨根をミニ膣にねじ込む超イキまくり4SEX 桃乃りん

  • momono rin censoreduniformschoolgirlSDABsod createkomatsu 17seishun jidaiSDAB-193SDAB1931sdab00193
    • 2021-09-11
    154 min

    [SCOP-737]I Went To An Illegal No-Panties Oil Massage Parlor Where I Could Cum Until My Balls Went Dry, With No Time Limits, And We Could Both Climax With Pleasure

  • censoredcreampiebig titsSCOPk m producescoop kmpSCOP-737SCOP737scop00737
    • 2021-09-14
    65 min

    HEYZO 2609 Deep Kiss, Furious Sex -Lascivious Teacher’s Seduction- – Asuka Motomiya

  • asuka motomiya uncensoredcreampieheyzo
    • 2021-10-01
    148 min

    [MIMK-096]I Met A Demonic Salt-faced Girl With Huge Tits And Insane Sex Drive At A Party Live Action Of Popular CG Comic About Fucking All The Plump Girls! Hatsu Ai Nenne

  • first love censoredcreampiebig titsMIMKmoodyzkubo stylemankitsuMIMK-096MIMK096mimk00096
    • 2021-10-02
    140 min

    [PKPD-164]H Cup Chubby Cosmetologist Fuck Buddy Misono Is Healing And So Cute, Misono Mizuhara

  • suwon miso censoredcreampiebig titsPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-164PKPD164pkpd00164
    • 2021-10-20
    131 min

    [GVH-305]The Worst Embarrassment Ever for the No. 1 Bunny Girl, No. 8. Himari Kinoshita

  • himari kinoshita himari hanazawa censoredslutsingle workGVHglory questGVH-305GVH305gvh00305
    • 2021-10-20
    62 min

    541AKYB-032 tomomi (24) i’ll get rid of it right away! ？？ h-cup girls with obscene areola (tomoe arakaki)

  • amateur censoredbig titsamateurakybakyb-032akyb032541akyb-032
    • 2021-10-25
    57 min

    [SHH-030]Cheating At The Massage Parlor With My Wife Right Nearby. Soothing Massage While Slipping My Dick In For Hip Shaking Cowgirl Fucking And A Creampie Load For The Perfect Ass On This Esthetician.

  • censoredslutSHHnatural highkansukeSHH-030SHH0301shh00030
    • 2021-10-29
    108 min

    [ADN-355]I Have Sex With My Father-in-Law... Minami Shiratori

  • minami shiratori censoredsingle workdramaADNattackerstakasugi ryouotona no dramaADN-355ADN355adn00355
    • 2021-10-30
    40 min

    H0930 ki211031 Megumi Shirakawa 29years old

  • amateur uncensoredh0930
    • 2021-11-02
    52 min

    FC2PPV 2398436 * Limited Time Price Until 11/8 [2480pt⇒1980pt] Dekachin Licking ★ Slender Beautiful Breasts Female College Student (21) ★ Raw Squirrel From A Blow Job On The Verge Of Explosion × 2 [cen]

  • amateur uncensoredfc2
    • 2021-11-19
    180 min

    [HNDS-073]Beautiful Temptresses In Sexy Cosplays At The Snack Bar Play With Their Nipples! Nipple Girls Creampie Campus Festival Shiramomo Hana Matsumoto Ichika Horikita Wan Tennen Mizuki

  • ichika matsumoto natural mizuki censoredcreampiecosplayHNDShonnakazampaHNDS-073HNDS073hnds00073
    • 2021-11-20
    179 min

    [SABA-737]I Just Want To Fuck...Fuck...Fuck Girls From All Over Japan! Amateur Pornography Tohoku Area

  • censoredbig titsamateurSABAskyu shirotoSABA-737SABA737saba00737
    • 2021-12-04
    121 min

    [RMER-009]A French Kiss Tastes Like Breast Milk. Misaki Sugisaki

  • misaki sugisaki censoredbig titssingle workRMERmare rare mousouzokuaraki tamaomareRMER-009RMER009rmer00009
    • 2021-12-10
    66 min

    [mla-050]喜保(26)

  • amateur censoredcreampiebig titsmlamla-050mla050mla-050
    • 2021-12-13
    82 min

    481SACZ-100 Reika & Yuka / Yuka

  • amateur censoredmarried womanamateursaczsacz-100sacz100481sacz-100
    • 2022-01-08
    214 min

    [BAZX-323][Completely Subjective] Let"s Have Ovulation Day Impregnation Sex with a Beautiful Maid Girl Who Allows Immediate Fellatio and Sex vol. 003

  • mao watanabe marina saito censoredcreampieblowjobBAZXbazookatodoBAZX-323BAZX323bazx00323



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored