censored javcensored creampie squirting big tits




FC2WAAANGODAUKGMILKVEMAKSBJCAWDSQTEDASDMIDENACRGMEMSSISPPPDGVHHDKANATRAUKGFSDSSONEZ

2020-12-21
85 min

[ZOZO-032]Minami Saitou

  • minami saito censoredZOZOsadistic villageZOZO-032ZOZO0321zozo00032
    • 2020-12-27
    160 min

    [LULU-049]This Colossal Tits Private Tutor Is Pressing Her Tits Against You And Whispering Dirty Talk Into Your Ear And You're Unable To Resist Her Temptation, So You Hid From Your Parents And Had Creampie Sex With Her Yuria Yoshine

  • yoshine yuria censoredcreampiebig titsLULUlunaticsvagmanLULU-049LULU049lulu00049
    • 2021-01-07
    124 min

    [JRZE-021]It's My First Time Filming My Affair Yui Furuse

  • yui furuse censoredcreampiemature womanJRZEcenter villagekotaro misatojurakuJRZE-021JRZE021h-086jrze00021
    • 2021-01-09
    125 min

    [IPX-604]I Hate My Boss So Badly, I Would Rather Die Than Fuck Him, But During Our Business Trip, To My Horror, We Were Booked Into The Same Room At A Hot Spring Resort Inn... And This Disgusting, Horny Old Man Made Me Cum, Over And Over Again. Minam

  • minami aizawa censoredbeautiful girlsingle workIPXidea pocketdishIPX-604IPX604ipx00604
    • 2021-01-13
    43 min

    230ORE-742 A sensei

  • amateur censoredcreampiebig titsoreore-742ore742ore-742
    • 2021-01-26
    129 min

    [STARS-324]My Colleague Is Kissing My Boss' Ass And It Pisses Me Off, So When I Found Out That Sh Was Working A Side Hustle At A Rejuvenation Massage Parlor That Gave Nookie On The Side, I Demanded Raw Sex And Creampie Pumped Her Full Of My Extra

  • makoto toda censoredcreampiesingle workSTARSsod createryo inugamisod starSTARS-324STARS3241stars00324
    • 2021-01-29
    237 min

    [OKAX-698]Home Invasion: Married Woman Gets Ravished 4 Hours

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-698OKAX69884okax00698
    • 2021-02-01
    120 min

    [NACR-396]Vestiges Of His Father: Widow Seduces Her Stepson Shoko Tokuyama

  • shoko tokuyama censoredblowjobmature womanNACRplanet plusbito sakurananakuruNACR-396NACR396h-237nacr00396
    • 2021-02-09
    60 min

    HEYZO 2455 Comforting With Marshmallow-Like Tits – Ayane Sakurai

  • ayane sakurai uncensoredcreampieblowjobheyzo
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-18
    153 min

    [PPPD-902]Almost At Her Graduation. This 40" J-Cup Is Searching For What She Really Wants To Do - Her Porn Debut Kokomi Akae

  • tamao akae censoredbig titssingle workPPPDoppaiPPPD-902PPPD902pppd00902
    • 2021-02-27
    72 min

    476MLA-030 Prickets Geki Echi Campaign Girl catches cum shot juice in the womb! !! Transcendent grind cowgirl who hits the tip of the chin on Portio and goes crazy! Sea pick-up ⇒ Saffle ⇒ Record summer memories with Gonzo ☆ Wheat-colored BODY 3 shots

  • amateur censoredcreampiesquirtingmlamla-030mla030476mla-030
    • 2021-02-27
    139 min

    [MCSR-426]A Married Woman's Creampie Adultery Vacation - Riho Fujimori

  • riho fujimori censoredcreampiebig titsMCSRbig morkalyumejimascottMCSR-426MCSR42657mcsr00426
    • 2021-02-27
    51 min

    C0930 ki210228 Mariko Miyazawa 24years old

  • amateur uncensoredc0930
    • 2021-03-02
    73 min

    FC2PPV 1708762 First shot ❤️ Massive vaginal cum shot to a fair-skinned indoor busty girl with little experience ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-03-06
    138 min

    [HUNTA-959]I Was On A Company Trip With My Big Tits Lady Bosses, And I Was The Only Guy, So It Was Like Heaven On Earth! They Played With My Cock In The Outdoor Bath, And The Evening Dinner Party Turned Into A Harlem Orgy Fuck Fest! We Went On Our Co

  • censoredcreampiebig titsHUNTAhuntercognac kaminohhh groupHUNTA-959HUNTA959hunta00959
    • 2021-03-11
    35 min

    [GRMR-037]嫉妬彼氏の束縛エッチ ～優しい彼のドSなお仕置き～

  • ako momona kou akemi mari koizumi hiroomi nagase censoredGRMRmura chleo hakusanGRMR-037GRMR037h-1534grmr00037
    • 2021-03-12
    115 min

    [DHT-247]Car Sex Challenge! Sumire Tanba

  • niwa sumire censoredbig titsDHThot entertainmentDHT-247DHT24759dht00247
    • 2021-03-13
    66 min

    H0930 ki210313 Gold Pack 20years old

  • amateur uncensoredh0930
    • 2021-03-25
    55 min

    230ORETD-858 Yukine

  • amateur censoredcreampieuniformoretdoretd-858oretd858230oretd-858
    • 2021-04-02
    166 min

    [JUL-527]Step Mother Lusts After Her Daughter's Husband 24 Hours A Day Ririko Kinoshita

  • kinoshita rinko censoredmature womanslutJULmadonnakogoro kindaichiJUL-527JUL527jul00527
    • 2021-04-13
    51 min

    499NDH-013 Men’s esthetician who spins huge breasts like a rampage cow! Refresh your body and soul with a vaginal pressure esthetic by a plump fair-skinned erotic BODY practitioner who is comfortable to hold! !! [Is it okay to have the mask remo

  • amateur censoredbig titsamateurndhndh-013ndh013499ndh-013
    • 2021-04-15
    240 min

    [ARAN-019]Locked Up And Tied Up! Female Bodies Reach The Limits Of Trembling Pleasure Through Rough Sex INFERNO BABE ULTRA FILM

  • censoredARANbabyentertainmentamateur girl madness bureauARAN-019ARAN019aran00019
    • 2021-04-18
    125 min

    [GMEM-029]Masochistic Plump Wife With Big Tits Gets Turned Into A Slut Sex Doll Awakening Haruna Wakatsuki

  • haruna wakatsuki censoreddeepthroatsingle workGMEMavs collector sbuddha davscollector s goldGMEM-029GMEM029gmem00029
    • 2021-04-24
    131 min

    [MRSS-111]My Big Booty Wife Protected Me From Thugs, And They Ended Up Taking It Out On Her Body... Ema Asahi

  • chaoyang ema censoredcreampiesingle workMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-111MRSS111mrss00111
    • 2021-04-30
    61 min

    Caribbeancom 043021-001 Dynamite: Non Suzumiya

  • non suzumiya uncensoredcreampiecaribbeancom
    • 2021-05-09
    59 min

    Pacopacomama 050921_474 Widow Runa Akasaka

  • amateur uncensoredpacopacomama
    • 2021-05-22
    68 min

    SIRO-4534 [First shot] [Cum convulsions body] [Foolery that dies] A slender beauty who fascinates the mermaid-like bounce on land. Her facial expression is sensual, and she climaxes many times .. AV application on the net → AV experience shooting 154

  • amateur censoredamateursirosiro-4534siro4534siro-4534
    • 2021-05-29
    57 min

    358WITH-102 Maron (24) S-Cute With Gonzo SEX With A Beautiful Woman Who Self-lives At The Cowgirl

  • amateur censoredcreampiebig titswithwith-102with102358with-102
    • 2021-06-11
    178 min

    [MIAA-454]Snake Tongued Anaconda Witch: I Will Make You Cum Over And Over Again By Licking Your Cock And Ass One After The Other Yumi Saeki Hana Kano

  • yuka saeki kanna flower censoredanalblowjobMIAAmoodyzkogoro kindaichieveryone s porn starMIAA-454MIAA454miaa00454
    • 2021-06-13
    97 min

    300MAAN-664 [Beautician who draws down with erotic massage] The best beauty with cool beauty is excited for her boyfriend! !! Virgin Ji ○ port also erection MAX in breathtaking perfect beautiful breasts! !! Sperm tank collapses by inserting cowgirl f

  • amateur censoredcreampieamateurmaanmaan-664maan664300maan-664
    • 2021-06-19
    87 min

    491TKWA-010 Yua

  • amateur censoredcreampieamateurtkwatkwa-010tkwa010491tkwa-010
    • 2021-06-22
    65 min

    FC2PPV 1882733 [Great breasts ♥] G cup older girlfriend [Magazine model] On the table, even if it is a type that is laid on the buttocks, it is very cute when it is etched ♀ Big breasts trembling and vaginal cum shot SEX leaked from saffle Personal s

  • amateur uncensoredfc2
    • 2021-07-01
    59 min

    H4610 ki210701 Sachie Murayama 34years old

  • amateur uncensoredh4610
    • 2021-07-03
    97 min

    200GANA-2521 A real record of how even beginners can easily take home on the same day! <Be sure to watch> You can have sex with you! !!

  • amateur censoredbig titsamateurganagana-2521gana2521200gana-2521
    • 2021-07-11
    61 min

    HEYZO 2566 Dirtying A No Face Showing Amateur Girl Vol.2 – Ryoko Kimijima

  • ryoko kimijima uncensoredcreampieheyzo
    • 2021-07-17
    189 min

    [REXD-371]Fucked In Front Of My Boyfriend...Teacher On Patrol During The School Trip, "She Should Be Knocked Out, So There's No Way She'll Wake Up!"

  • censoredcreampieschoolgirlREXDredmanji groupREXD-371REXD371rexd00371
    • 2021-07-23
    155 min

    [BANK-047]Open Air Creampie - Nympho With Colossal Tits Can't Live Without Daily Sex - Lecherous Lady

  • censoredcreampiebig titsBANKpussy banktake chanBANK-047BANK047h-1495bank00047
    • 2021-07-29
    84 min

    FC2PPV 1946094 [Virgin Immediate Scale] Immediately After Meeting Ace, If You Can Endure The Immediate Scale For 5 Minutes, Vaginal Cum Shot Is Ok * Complete Appearance, Cum Swallowing, Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-07-29
    25 min

    FC2PPV 1945098 [Uncensored] Umeda _ Freeter (I Gave A Vaginal Cum Shot To My Daughter Who Had Trouble Paying Due To Reduced Income In Corona)

  • amateur uncensoredfc2
    • 2021-08-03
    57 min

    422ION-0076 I Decided To Shoot Her At The Hotel When My Boyfriend Met On SNS That I Was Not Satisfied With In A Light Night! !!

  • amateur censoredamateurbeautiful girlionion-0076ion0076422ion-0076
    • 2021-08-05
    60 min

    FC2PPV 1957744 [Personal Shooting] Gonzo Without Permission To A Neat Girl Who Looks Like Yu ● Nya

  • amateur uncensoredfc2
    • 2021-08-21
    129 min

    [MKON-060]My Girlfriend Used To Be A Clean Freak. Now She"s Getting Constantly Creampied By A Middle Aged Man In A Smelly Room Filled With Garbage, Starring Rei Kuruki

  • satoshi kuruki censoredcreampieuniformMKONkaguya hime pt mousozokuyumesaki ichiroumikonMKON-060MKON060mkon00060
    • 2021-09-02
    125 min

    [AARM-013]Making Him Come While Passionately Kissing Him And Playing With His Nipples And Dick

  • mizuki yayoi okawa tsukino censoredsluthandjobAARMaroma kikakusatoshimaniaaromaAARM-013AARM013aarm00013
    • 2021-09-05
    106 min

    [LOL-199]Y********l Specialty. Rough Sex From Step-father During Hellish Hot Springs Vacation With Masochistic Girl. Ten Hasumi

  • hasumiten censoredcreampiebeautiful girlLOLglayzrori senkaLOL-199LOL19912lol00199
    • 2021-09-09
    181 min

    [SUN-029]Exhibitionist Date With Shy Cosplayer Girl. Cum-D***king Doll

  • sumire matsu censoredbig titshandjobSUNsuntanaka baconSUN-029SUN02913sun00029
    • 2021-09-11
    161 min

    [TPIN-012]The Melancholy Of The Auntie In The K*d"s Room - A Horny Stepbrother With His Stepmom And Stepsister

  • censoredcreampielesbianTPINtsubakihoinTPIN-012TPIN012tpin00012
    • 2021-09-17
    53 min

    FC2PPV 2214167 [Uncensored] Pleasure Awakens With The First 3P !! Two Different Iki Intense Heat Sex Mari (21 Years Old) & Rie (20 Years Old)

  • amateur uncensoredfc2
    • 2021-09-17
    123 min

    [TPPN-206]First-time Debut For TEPPAN! Maina Yuri Is A Gal With Big Tits That Gives Into Waves Of Pleasure! Crazy Blowjob BUKKAKE And Wet Messy Sex.

  • yuuri censoredbig titssingle workTPPNteppanTPPN-206TPPN206tppn00206
    • 2021-10-01
    145 min

    [JUNY-045]Her Tempting Ass Is So Big It Pokes Out Without Her Knowing! Huge Ass Teacher"s Anal Climax Life, Shiori Kimura

  • shiori kimura censoredcreampiebig titsJUNYfitchnikuyokuJUNY-045JUNY045juny00045
    • 2021-10-02
    174 min

    [SORA-338]Dirty Aphrodisiac, Exhibitionist Sex with You - Hinako Mori

  • hinako mori censoredsingle workSORAyama to sorahimurokkuSORA-338SORA338sora00338
    • 2021-10-03
    34 min

    233BAT-094 Anju

  • amateur censoredamateurbatbat-094bat094233bat-094
    • 2021-10-07
    87 min

    [HIMA-095]Genuine A Stepmother/Stepson Fuck Fest A Stepmother And Stepson Have Nowhere To Turn To But Each Other, As They Engage In Forbidden Impregnation Sex Kanako Haraguchi

  • natsuko haraguchi censoredcreampiemarried womanHIMAcenter villageshibuyahanazono center villageHIMA-095HIMA095h-086hima00095
    • 2021-10-30
    160 min

    [LULU-105]My New Wife Has A Daughter (In Other Words, My Stepdaughter) Who Has Minimal Nipples, So Whenever My Wife Is Not Looking, I Tweak Those Nipples And She Helps Me Ejaculate. Lala Kudo

  • lara kudo censoredcreampiesingle workLULUlunaticsvragmanLULU-105LULU105lulu00105
    • 2021-11-04
    150 min

    [SHIND-020]Stalker M"s Train Touching And Home Invasion Records #38 And 39

  • censoredamateurSHINDshinkirousuzuki o maSHIND-020SHIND020h-1560shind00020
    • 2021-12-18
    120 min

    [KSBJ-173]I Had Sex With My Step-Father And Had The Entire Thing Filmed On Video... Mizutani Aoi

  • aoi mizutani censoredcreampieblowjobKSBJksb kikaku emmanuellesakura ninKSBJ-173KSBJ173ksbj00173



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored