censored javcensored documentary delusion group jav




FC2DASDHDKAAUKGWAAAPPPDMEYDFSDSSPREDVEMACAWDROYDABWCJODAWDDTTGMEMATIDHMNVENUVENX

2020-10-14
481 min

[RVG-123]A Complete Record Of What This Private Tutor Did To His Big Tits S*****t BEST vol. 5

  • natsu natsu misao otowa censoredbig titsschoolgirlRVGglory questRVG-123RVG12313rvg00123
    • 2020-10-15
    34 min

    [orec-609]かおりさん

  • amateur censoredbig titsamateurorecorec-609orec609orec-609
    • 2020-10-30
    481 min

    [HEZ-222]First Class Picking Up Girls! Famous Mature Woman Creampied 8 Hours. Gorgeous Celebrity Deluxe 6

  • censoredmarried womanamateurHEZhot entertainmentstudio zeroaunt chHEZ-222HEZ22259hez00222
    • 2020-11-06
    480 min

    [HHAP-005]"If You Don't Want To Get Creampie Fucked And Pregnant, Then Call Another Girl And Make Her Cum Here!" A Horny Boys Chain Reaction Creampie G*******g Special - S********ls / A Girls Dorm / A Big Tits Mothers Group -

  • horikoshi nagisa yuma arima censoredcreampieHHAPapachemasanorihhh groupHHAP-005HHAP005hhap00005
    • 2020-11-07
    136 min

    [CMF-057]Desert Woman Commando's POW Bullying Order June Lovejoy

  • june lovejoy censoredsingle workCMFcinemagicdirty kudoninhuCMF-057CMF057cmf00057
    • 2020-11-13
    151 min

    [MIFD-136]Shy Computer Programmer With No Friends At Work Wants To Become Japan's Kinkiest Slut Suzuka Ninomiya

  • ninomiya suzuka censoredblowjobbeautiful girlMIFDmoodyzusa pyonmoodyz freshMIFD-136MIFD136mifd00136
    • 2020-11-22
    121 min

    [CJOD-265]Sharing A Room With Two Colossal Tits Girls. Curing Sweaty Cowgirl Intercourse Looking At The Jiggling Tits Of My Two Step-nieces Who Had Become Women, I Gave Them Creampies One After Another - Sachiko, Ruka Inaba

  • sachiko inaba censoredcreampiebig titsCJODchijo heavensapporo taroCJOD-265CJOD265cjod00265
    • 2020-11-22
    190 min

    [MISM-188]Deep Throat Wonderland Rough And Hard Deep Throat That Doesn't Stop Despite Tears Or Vomit Mitsuha Higuchi

  • mitsuha higuchi censoredbeautiful girlMISMemumusume labblack heart loveMISM-188MISM188mism00188
    • 2020-11-26
    97 min

    [hoi-147]堀北(21)

  • amateur censoredamateurbeautiful girlhoihoi-147hoi147hoi-147
    • 2020-11-28
    149 min

    [JUFE-227]4 Years Until Marriage And Always Satisfying Her Sexual Urges Then Decides To Have Her First Raw Creampie Sex! Miyabi Midorikawa

  • midorikawa miyabi censoredcreampiebig titsJUFEfitchmichiru arashiyamaJUFE-227JUFE227jufe00227
    • 2020-12-11
    32 min

    HEYZO 2437 Rei Now Experiences Double Barrel And Multiple Creampies To Be A Pro Prostitute – Rei

  • rei uncensoredheyzo
    • 2020-12-18
    61 min

    FC2PPV 1600613 [No] I was able to take the best video that is inevitable for permanent storage! Super erotic and super cute teens begging for vaginal cum shot so seeding perfectly! This is a video that you can masturbate more than 100 times! !! 【self

  • amateur uncensoredfc2
    • 2020-12-20
    71 min

    200GANA-2390 Seriously Nampa, first shot. 1571 Give healing to the receptionist of Moe glasses in Shinjuku! ？？ Because daily stimulation is not enough, I fill my heart with a hard piston of Ji ● Po w panting for sex beyond imagination! !!

  • amateur censoredsquirtingamateurganagana-2390gana2390200gana-2390
    • 2020-12-24
    108 min

    [FUGA-044]Soapland Brothel Reunion With My Ex-Husband - Raw Creampie Sex With The Man I Never Wanted To Fuck Again - But I Loved It Yuki Fukuda

  • yuki fukuda censoredcreampiemarried womanFUGAcenter villagesouthern earthparadise center villageFUGA-044FUGA044h-086fuga00044
    • 2020-12-26
    187 min

    [CLUB-625]Sharing A Room With Big-Tits Boss Who Is A News Anchor On A Business Trip... She Couldn't Resist Fucking Her Subordinate Who Has An Unequalled Huge Cock!

  • censoredCLUBhentai shinshi clubCLUB-625CLUB625club00625
    • 2021-01-20
    119 min

    [TENX-18112]Mature Woman Posted: 40-Something Lovers

  • censoredmarried womanamateurTENXtennin xtaro tsuboTENX-18112TENX18112h-1542tenx18112
    • 2021-01-29
    50 min

    Pacopacomama 012821_427 Wives Drink Cum 116 Kanon Mikoshiba

  • amateur uncensoredpacopacomama
    • 2021-02-09
    21 min

    FC2PPV 1679003 No communication [Individual shooting] Prefectural general course (2) Two strange uncles continuously vaginal cum shot without permission because of runaway funds.

  • amateur uncensoredfc2
    • 2021-02-21
    121 min

    [DASD-819]In My Job-hunting Resume... When I Wrote "Small Breasts" In My List Of Advantages, I Was Called Into Another Room. Risa Shiroki

  • risa shirojo censoredbeautiful girlsingle workDASDdaskirinDASD-819DASD819dasd00819
    • 2021-03-14
    16 min

    10musume 031421_01 Secret Pussy Collection: Yuko Ikeda

  • amateur uncensored10musume
    • 2021-03-21
    118 min

    [HND-964]My Fiancee Confessed To Me That Right Before Our Wedding, My Dad Had Impregnated Her. And He Had Gotten To Creampie Fuck Her Before I Got The Chance Amu Hanamiya

  • hanamiya amu censoredcreampiebig titsHNDhon nakakitorune kawaguchiHND-964HND964hnd00964
    • 2021-03-22
    103 min

    241GAREA-502 Riko

  • amateur censoredbig titsamateurgareagarea-502garea502241garea-502
    • 2021-04-12
    121 min

    [HONB-211](Momo) Flat Chested Girl With An Anime Voice (Saki) Super Rare Gal

  • censoredbig titsbukkakeHONBmercurythe first shibuya special f e headquarHONB-211HONB211h-1133honb00211
    • 2021-04-17
    118 min

    [DASD-852]My Father In Law Fucks Me Because It's The Only Way My Husband Can Get Off In-House Consensual Cuckholding Yu Shinoda

  • shinoda yu censoredcreampiesingle workDASDdasrokusaburo mishimaDASD-852DASD852dasd00852
    • 2021-04-17
    150 min

    [DASD-853]Cock-Loving Transsexual Teacher Controls Your Cum Riyu Nagisa

  • nagisa riyu censoredslutDASDdassmasanoriDASD-853DASD853dasd00853
    • 2021-05-14
    120 min

    [MVSD-465]Cock Licking Blowjob Loving Slut Will Run To Suck Cock As Soon As You Call! Arisu Nanase

  • alice nanase censoredschoolgirlblowjobMVSDm s video groupMVSD-465MVSD465mvsd00465
    • 2021-05-21
    165 min

    [CAWD-224]19 Years Old Is Still In The Middle Of Youth New Generation Beautiful Y********l Riri Sena Porn Debut

  • lily sena censoredsquirtingbeautiful girlCAWDkawaiitake dCAWD-224CAWD224cawd00224
    • 2021-05-21
    117 min

    [NNPJ-448]This Is The First Time I've Ever Used A Dating App To Meet Men... Bored, Sex-Starved Married Woman Goes To A Love Hotel Just This Once With Another Man Ms Aki

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-448NNPJ448nnpj00448
    • 2021-05-24
    47 min

    FC2PPV 1834656 [Personal shooting, vaginal cum shot, pt off for a limited time] 33-year-old child and wife, who should have rubber, could not stand being rubbed with raw cock and accepted raw insertion …

  • amateur uncensoredfc2
    • 2021-06-29
    121 min

    [SDDE-650]An Introverted S*****t Makes A Contract With A Succubus And Has Her Slut Debut! She Paralyzes Men With Her H*******m Powers And Turns Them Into Masochists! - Meru Kusumi

  • kusumi censoredcreampiecosplaySDDEsod createdazai chinposenzSDDE-650SDDE6501sdde00650
    • 2021-07-01
    120 min

    [HDKA-237]Naked Housewife Living In Koganei City Miki Sunohara (28)

  • future sunohara censoredcreampiemature womanHDKAplanet plusdirector orafu shukouHDKA-237HDKA237h-237hdka00237
    • 2021-07-02
    118 min

    [SSIS-107]Step Sister Suddenly Wants To Fuck! We'd Get In Trouble If We Were Found Out So I Could Only Moan Quietly As She Ravished Me Shion Yumi

  • evening beauty censoredbig titsslutSSISs1 no 1 stylekirinSSIS-107SSIS107ssis00107
    • 2021-07-15
    130 min

    [BIJN-203]The Documentary The Ultimate Animalistic Sex Beautiful Married Slut Loses Her Mind Joining In On A Creampie Orgy Ai Mukai

  • ai mukai censoredsingle workBIJNbijin majo emmanuelleBIJN-203BIJN203bijn00203
    • 2021-07-16
    134 min

    [HZGD-193]Sex In Paradise Lost - Secret Meetings Over And Over, An Intensifying Love...Forbidden Adultery - Kana Morisawa

  • kana morisawa kanako iioka censoredcreampiesingle workHZGDmarried woman flower garden theaterzampaimage married woman flower garden theatHZGD-193HZGD193h-1100hzgd00193
    • 2021-07-18
    179 min

    [NASH-547]MILF Cuckolding and Fakecest Lewdly Stuffing His Rock-Hard Cock Into His Stepmother, Sister-In-Law, and Step-Aunt Until He Cums

  • censoredcreampiebig titsNASHnadeshikokakki uguisudaniNASH-547NASH547nash00547
    • 2021-08-02
    61 min

    498DDH-027 A Self-Proclaimed "Weak To Push" Woman Is Pushed And Waits! ？？ A Beautiful Employee Who Is Being Resurrected By Her Husband And A Nice Atmosphere In The Company Car … → Immoral Sex That Fills Loneliness With Ji ● Po Even Thoug

  • amateur censoredmarried womanamateurddhddh-027ddh027498ddh-027
    • 2021-08-07
    239 min

    [NASH-555]4 Hours Of Voyeur Footage From A Love Hotel 3 - Cheating Wives, MILF Escorts, Horny Female Bureaucrats And Businesswomen - 18 Couples Secretly Filmed Sucking And Fucking During Lockdown

  • censoredmature womanNASHnadeshikoloveho tousatsu.networkNASH-555NASH555nash00555
    • 2021-08-20
    133 min

    [HZGD-195]My Ex-Girlfriend Got Married With My Best Friend, So I Stole Away Her Heart And Soul And Her Body With Kissing Creampie Pure Loving Sex Sakura Tsukino

  • tsukino sakura censoredcreampiesingle workHZGDhitodzuma hanazono gekijouzampaHZGD-195HZGD195h-1100hzgd00195
    • 2021-09-02
    43 min

    FC2PPV 2127750 980 Yen [4K Video] Orgy! 3 Barrage Of 4P Vaginal Cum Shot! !! Massive Squirting Continuous Acme! Popular Loli Ti ○ Toker! ♪ Raw Vaginal Cum Shot! 18-Year-Old Jd1 Neru-Chan Chapter 1_ Bonus

  • amateur uncensoredfc2
    • 2021-09-29
    153 min

    [IBW-841]My Tanned Stepdaughter Hits The Sweet Spot Lala Height: 142cm

  • amateur censoredbeautiful girlIBWi b worksIBW-841IBW841
    • 2021-10-01
    99 min

    [ADN-346]Dear, Please Forgive Me... A Second Wife"s Conflict - Minami Shiratori

  • minami shiratori censoredsingle workdramaADNattackersnagira kenzootona no dramaADN-346ADN346adn00346
    • 2021-10-09
    240 min

    [NASH-585]What Are You Going To Do To This Old Lady？ Even If You Are A Mature Woman (Landlady/Maid/Woman Guest) At A Hot Spring Inn Who Has Forgotten How To Be A Woman, There Is Nothing You Can Do If You Have A Dick In Your Face In A Locked Room...

  • censoredNASHnadeshikoonsen jukujo kenkyuukaiNASH-585NASH585nash00585
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-19
    151 min

    [DVDMS-739]Light Skin And Huge Ass On An Older Housewife That Gets A Quickie! Big Dick Is Held Captive By A Married Woman That Satisfies Herself With It Till The Next Day, Getting Non-stop Creampie Loads - 9. Kurumi Kirishima

  • kirishima walnut censoredcreampiebig titsDVDMSdeepsnagase swingDVDMS-739DVDMS739dvdms00739
    • 2021-12-03
    180 min

    [MIDV-013]Quiet, Anti-social Longtime Friend Offers Irresistible Temptation. Full-on Panty Shot Showoff. Catching A Glimpse Gives Me A Huge Bulge From My Big Dick, Making Her Hot And Soaking Wet With Excitement When She Sees It! Hana Kotone

  • ryoko sena miu natsume miu harukawa lisa natsume iori censoredlesbianmature womanMIDVmoodyzgoemonmoodyz divaMIDV-013MIDV01348midv00013
    • 2021-12-04
    98 min

    [BIJN-211]The Documentary Instinct-Baring Orgasmic Sex A Maso Big Tits Young Wife With A Highly Sensual Body Is Going Crazy With Cumtastic Pleasure Mei Satsuki

  • satsuki mei censoredcreampiesingle workBIJNbijin majoBIJN-211BIJN211bijn00211
    • 2021-12-23
    124 min

    [SPRD-1498]Journey. A Mother And Stepson"s Two-Person Trip. Yu Kawakami

  • yu kawakami morino morino censoredmarried womanmilfSPRDtakara videorokusaburo mishimaaleddinSPRD-1498SPRD149818sprd01498
    • 2022-01-04
    61 min

    1Pondo 010422_001 Braless Neighbor In The Morning: Non Suzumiya

  • amateur uncensored1pondo
    • 2022-01-05
    60 min

    [010522-001]Debut Vol.72: Oh no! My sexual sensitivity keeps increasing!!

  • ai minami uncensoredcreampiehandjobcaribbeancom
    • 2022-01-21
    93 min

    [529STCV-058]【 性欲旺盛週7オナニストin 大山】欲求不満なオナニー大好きデカ尻美女と一緒に大人のおもちゃレビュー♪新品ローター

  • amateur censoredcreampieamateurstcvstcv-058stcv058529stcv-058
    • 2022-01-21
    118 min

    [HMN-113]I Was Invited By My Frustrated Neighbor To Watch Porn With Her. In The Middle Of Inserting The Video, She Gets All Rutted Up And Starts Cumming Over And Over Again Megu Mio

  • mio meg censoredcreampieblowjobHMNhon nakahiroaHMN-113HMN113hmn00113
    • 2022-02-04
    121 min

    [SSIS-321]Enjoy 100x The Pleasure During Sex With An Amazingly Beautiful Young Woman After A Stint Of Celibacy. Fua Kaeda

  • kaede fua censoredslutsingle workSSISs1 no 1 stylemichiru arashiyamaSSIS-321SSIS321ssis00321
    • 2022-02-11
    117 min

    [BLK-558]Friends With Benefits 01. Finding A Fuck Buddy Gal On A Dating App To Go Out Partying With, Leading To Intense Sex And Massive Squirting!

  • censoredcreampiebig titsBLKkira kirakira kira black galBLK-558BLK558blk00558
    • 2022-02-18
    476 min

    [OFJE-350]The Legend Of No.1 STYLE Saki Okuda In Her 10th Anniversary Memorial Best Hits Collection Her Newest 12 Titles 8 Hours

  • saki okuda censoredbig titssingle workOFJEs1 no 1 styleOFJE-350OFJE350ofje00350
    • 2022-02-26
    57 min

    10musume 022622_01 The Structure Of Woman: Please Measure The Undeveloped Part Of Me Sai Kurashina

  • amateur uncensored10musume
    • 2022-03-05
    122 min

    [RMER-012]Breast Milk Ranch - Fumi Ayakawa

  • ayagawa fumi censoredsingle workRMERrare daydream tribetamao arakimareRMER-012RMER012rmer00012



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored