censored javcensored high vision creampie amateur




FC2ROYDVENXHDKAKBICESDNACXSSNIGMEMADNAVSAPPPDSTARSMEYDAWDABWCAWDHZGDAUKGSQTEMVSD

2020-09-21
118 min

[APNS-204]Young Lady Training Tease And Fill Up. 30 Days Of Fucking Until Pregnant And Full Of Cock And Cum Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-204APNS204apns00204
    • 2020-09-24
    51 min

    FC2PPV 1509629 [Autumn sale 1980pt → 1200pt] The first door restraint ◉ seriously died ❤️ De M serious temporary staff is a shaved beauty ❤️ Convulsions seriously died twice with the first electric massager There is a purchase privilege

  • amateur uncensoredfc2
    • 2020-09-24
    61 min

    [MIHA-047]Mr. Michiru's Fifth Anniversary Exclusive Actress Auditions Entrant Number 13 Mizuki Yayoi

  • mizuki yayoi censoredbeautiful girlsingle workMIHAmr michirusaitamr michiru s sex club videosMIHA-047MIHA0471miha00047
    • 2020-10-02
    35 min

    [BTH-074]I Want To Shower This Woman With Cum Face Semen Splatters Aimi Yoshikawa

  • yoshikawa aimi censoredbig titssingle workBTHchobitchchovicBTH-074BTH074h-1435bth00074
    • 2020-10-04
    63 min

    HEYZO 2364 Wanna Fuck A Girl In Gym Shorts! – Reina Oume

  • reina oume uncensoredcreampieheyzo
    • 2020-10-16
    63 min

    [DHT-171]Akari Asagiri Will Break You In Nice And Gentle - Guys Lose Their Virginity On Camera

  • censoredbig titsmature womanDHThot entertainmentkazuki enDHT-171DHT17159dht00171
    • 2020-10-16
    188 min

    [ABW-018]Super! See-Through Uniform Pervert Academy, Class 09: Sheer-Fetish Fuckfest With Her Beautiful Naked Body Showing Through Her Clothes! Ann Mitsumi

  • an mitsumi censoredbig titssquirtingABWprestigecharlie nakataabsolutely wonderfulABW-018ABW018118abw00018
    • 2020-10-27
    129 min

    [GONE-018]Mature Woman With Sexy, Sultry Brown Hair And Tingling, Tanned Skin Explore The Boundaries Of Erotic Potential With A Woman Over 35 Ayaka Muto

  • ayaka muto censoredmature womansingle workGONEmercurybirdman teppeian erotic tanned elder sisterGONE-018GONE018h-1133gone00018
    • 2020-10-31
    57 min

    [NYH-047]Sex With My Busty Stepdaughter At An Outdoor Hot Spring Ruka Inaba

  • ruka inaba censoredNYHdirectorsdirectorsnyanjiang houseNYH-047NYH0471nyh00047
    • 2020-11-13
    60 min

    [PARATHD-3027]Picking Up Girls At A Coin Laundromat Frequented By College Girls Living Alone (2) - Going Up To Their Rooms To Bang Bang Bang!

  • censoredamateurPARATHDparadise tvPARATHD-3027PARATHD3027parathd03027
    • 2020-11-25
    61 min

    SIRO-4325 [First shot] [Concentrated attack on the back of the vagina] [Screaming active JD] An active female college student who enjoys college life and has a good feeling. Screaming for pleasure that boyfriends in the same circle can not taste .. A

  • amateur censoredamateursirosiro-4325siro4325siro-4325
    • 2020-12-10
    92 min

    [OKZ-014]Mature Goddess - Sex-Starved 40-Year-Old Woman Ryo Gets A Sexy Secret Part-Time Job Without Telling Her Family - Last Time She Had Sex Was Several Years Ago. Mature Married Woman On The Verge Of Exploding Due To Unfulfilled Desires Has A Sup

  • ryo fukutomi censoredcreampiemature womanOKZdaddy s private photosgodly mature womanOKZ-014OKZ0141okz00014
    • 2020-12-10
    53 min

    FC2PPV 1601468 [Complete appearance → It’s really dangerous if you get caught] Her friend boyfriend! The first 3P❤ G cup busty girl to argue! Cock-loving NTR reappears ❤ Paipan pussy G-spot Goryu Egu is raw ♪ First ever 4 consecutive vaginal cum

  • amateur uncensoredfc2
    • 2020-12-12
    120 min

    [EBOD-789]J-Cup Extra Thick Delivery Super Aggressive Type Slutty Girl Hunts Men With Extremely Slutty Outfits Chitose Yuki

  • chitose in the evening censoredcreampieslutEBODe bodyichigoharaEBOD-789EBOD789ebod00789
    • 2020-12-20
    118 min

    [CAWD-154]Shared Room NTR After The Event I Had Long Harbored Secret Feelings For My C***dhood Friend, And Now We're Having A Horny Good Time Having Creampie Sex Until We Had Depleted All Of Our Lust Yui Amane

  • amane yui censoredcreampiebeautiful girlCAWDkawaiiamazing meatCAWD-154CAWD154cawd00154
    • 2020-12-25
    482 min

    [IBW-808]"No More, Please..." Stepdaughters Ravished Over And Over By Their Stepdads - Footage Compilation 2 Discs, 8 Hours

  • amateur censoredIBWi b worksIBW-808IBW808
    • 2020-12-31
    480 min

    [HHAP-007]A Best Hits Collection Of Shame - 20 Sensual Girls Who Got Their Nipples Tweaked -

  • suzuki akina narumiya harua censoredbeautiful girlHHAPapachehhh groupHHAP-007HHAP007hhap00007
    • 2021-01-11

    FC2PPV 1616208 [Personal shooting] Miso 20 years old Selfie masturbation remastered version [Limited time]

  • amateur uncensoredfc2
    • 2021-01-24
    76 min

    300NTK-507 Bashabasha Squirting Angel Class Beautiful Girl Advent! !! Still growing Echi Echi F cup is also Binkan’s generalized erogenous zone Natural boned nasty the etch SEX In addition, lewd goddess! !! Of course, the fluffy famous instrumen

  • amateur censoredcreampiesquirtingntkntk-507ntk507300ntk-507
    • 2021-02-05
    38 min

    359TYVM-128 H Cup Yariman Big Breasts Wife Aphrodisiac Oil Pleasure Creampie Sex! !!

  • amateur censoredcreampiebig titstyvmtyvm-128tyvm128359tyvm-128
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-11
    124 min

    [NSM-028]An Aphrodisiac Oil Massage Peeping & Creampie Fucking With Amateur Girls VOL.28 We Used This Compound Of Super Powerful Aphrodisiacs Mixed Into Massage Oil And Used It On These Unsuspecting Ladies, And They Were Surprised To Find Their Bo

  • gloss hall shiori endo bookmark satoshi yamaguchi censoredcreampieNSMnishi shinjuku massage main officeaphrodisiac massageNSM-028NSM028h-1342nsm00028
    • 2021-02-27
    33 min

    FC2PPV 1704769 A masterpiece K cup daughter Gonzo edition! After all the K cup was amazing w Wrapped in fluffy huge breasts and vaginal cum shot while dreaming ♥ * High quality version & review benefits included ♪ [Personal shooting / original]

  • amateur uncensoredfc2
    • 2021-03-06
    209 min

    [HUNBL-035]Irrumatio x Creampie Sex x Bukkake G*******ging Sex This Bitchy Female Employee Is Always Hanging With The Guys And Doesn't Seem To Have An Ounce Of Sexuality, So We Made Her Suck Dick! And Have Creampie Sex! And Then We Bukkake Splatt

  • censoredcreampiedeepthroatHUNBLhuntercognac kaminohhh groupHUNBL-035HUNBL035hunbl00035
    • 2021-03-11
    264 min

    [PIYO-108]Do You Want Me To Be Your First... Ichika Matsumoto Fan Thanksgiving Day! Intimacy, Makeouts, Sweetly Breaking In Virgin Guys - We Recruited 3 Male Virgins From Social Media To Have Their First Experiences With Her!

  • ichika matsumoto censoredbeautiful girlPIYOchickclown fieldamaenboPIYO-108PIYO1081piyo00108
    • 2021-03-22
    86 min

    420SWEET-013 Nochiko (18)

  • amateur censoreduniformschoolgirlsweetsweet-013sweet013420sweet-013
    • 2021-03-25
    63 min

    FC2PPV 1740961 [Personal shooting] ♀ 297 Female college student Miyabi-chan, 18 years old, 2nd time. (LOL)

  • amateur uncensoredfc2
    • 2021-04-07
    80 min

    259LUXU-1402 Luxury TV 1388 A talented female doctor appears in AV in search of extraordinary life! Entrust yourself to a man to fill in the daily sufficiency … A beautiful body that trembles with pleasure! The elegance that drifts even when you

  • amateur censoredbig titsamateurluxuluxu-1402luxu1402259luxu-1402
    • 2021-04-07
    66 min

    474MUSUME-003 Himari Part1

  • amateur censoredsquirtinguniformmusumemusume-003musume003474musume-003
    • 2021-04-15
    122 min

    [AKDL-101](Girls You Can Fuck At Work) I Trained My Nurse Fuck Buddy On The Job - Creampie Sex And Cum Swallowing Footage (Shizuka, Age 22) Shizuka Sugisaki

  • shizuka sugisaki censoredcreampiebeautiful girlAKDLaquinoriaquinoriaknrAKDL-101AKDL1011akdl00101
    • 2021-06-05
    110 min

    [BKD-264]Family Fun [Higashiaizu Road] Shigure Maya

  • maya shigure censoredmature womansingle workBKDrubytobijiBKD-264BKD264bkd00264
    • 2021-06-19
    148 min

    [JUL-620]This Rare Bride With A Beautiful Face Is Finally Ready For Her First Creampie! All Alone For A Sweaty Fuck With A Gorgeous Part-Timer... Hitomi Honda

  • honda hitomi censoredcreampiemature womanJULmadonnakitorune kawaguchiJUL-620JUL620jul00620
    • 2021-07-13
    129 min

    [SDAB-189]"Teacher is So Cute" - S*****t Rides His Cock so Hard While He Plays with Her Nipples and She Doesn't Waste a Drop of his Cum. Ran Sakita

  • sakida run censoredcreampieschoolgirlSDABsod creategoemonone s youthSDAB-189SDAB1891sdab00189
    • 2021-07-15
    130 min

    [BIJN-203]The Documentary The Ultimate Animalistic Sex Beautiful Married Slut Loses Her Mind Joining In On A Creampie Orgy Ai Mukai

  • ai mukai censoredsingle workBIJNbijin majo emmanuelleBIJN-203BIJN203bijn00203
    • 2021-07-16
    72 min

    383REIW-082 Naru

  • amateur censoredbig titsamateurreiwreiw-082reiw082383reiw-082
    • 2021-08-05
    240 min

    [SIS-126]Why Is My Big Stepsister So Sexy!？ Experience The Mind-Blowing Temptation, Thrill And Guilt Of Fucking Your Big Stepsister In The Family Home 4 Hours

  • censoredcreampieslutSISgrayssisterSIS-126SIS12612sis00126
    • 2021-08-17
    68 min

    FC2PPV 2038379 [Half Price Left, Fertilization Times! ] ♀ 237 Female College Student Shio ◯ -Chan 20 Years Old 3rd Time: A Devoted Blowjob Of A Fair-Skinned, Slope-Based Beautiful Girl With A Boyfriend, Vaginal Cum Shot, Fertilization, And Apt Pregna

  • amateur uncensoredfc2
    • 2021-08-20
    150 min

    [CJOD-309]Librarian Girl Talks Dirty While Having Sopping Wet Raw Cowgirl Sex, Starring Yuu Kawakami

  • yu kawakami morino morino censoredcreampiesingle workCJODbisapporo tarouchijo hebunCJOD-309CJOD309cjod00309
    • 2021-08-29
    48 min

    292MY-457 Emily Kawabata 1

  • amateur censoredbig titsmarried womanmymy-457my457292my-457
    • 2021-09-11
    140 min

    [APKH-185]The Talented S*********l Class Representative And Her Shameless Teacher Personal Sex Tape In Love Hotel You Can Clearly See Her Ass As He Pumps Into Her From Behind...Misuzu Kashi

  • kashii misuzu censoredschoolgirlblowjobAPKHaurora project annexhAPKH-185APKH185apkh00185
    • 2021-09-17
    84 min

    [VEC-495]The Mom"s Friend Asaka Tomita

  • asaka tomita censoredcreampiemature womanVECvenuskaniemegami venusVEC-495VEC495vec00495
    • 2021-09-17
    120 min

    [MUDR-162]Gal Runs Away From Home And Gets Into Harlem. Beginning Room Mate Experience With Girlfriend Edition. Pure Light Skinned Gal And Energetic Dark Skinned Gal Come Together For A Dream Reverse Threesome Lifestyle. Hana Himesaki, Himari Kinoshi

  • himesaki hana himari kinoshita himari hanazawa censoreduniformMUDRmukuMUDR-162MUDR162mudr00162
    • 2021-10-01
    128 min

    [JUTA-122]The Best!! A 30-something WIfe"s First Undressing AV Document - Yukina Morisawa

  • yukina morisawa censoredcreampiebig titsJUTAjuku onna japan emmanuellekongouriki marujuku onna japanJUTA-122JUTA122juta00122
    • 2021-10-07
    93 min

    [OKS-121]Yume Natsuki. Wet And Glistening In A Tight Fitting School Swimsuit. Cute Girls In School Swimsuits For Tons Of Wet Fun! Peeping While They Change To See Everything From Small To Big Tits, Shaved Pussy, Pussy Hair, Arm Pits, And Other Fetish

  • natsuki yume censoredschoolgirlbeautiful girlOKSoyaji no kosatsukami sukumizuOKS-121OKS1211oks00121
    • 2021-10-09
    104 min

    [QRDA-135]Kat Suits Women - 3 Sisters

  • reiko tsujigami maki naomi censoredanalQRDAqueen roadkui nro doQRDA-135QRDA135qrda00135
    • 2021-10-14
    62 min

    336KNB-176 A Beautiful Wife Who Decides To Appear In An AV And Shakes A Ripe Erotic Body And Drowns In Sex With Other Than Her Husband. 69 At Miyahara Station, Saitama City, Saitama Prefecture

  • amateur censoredbig titsmarried womanknbknb-176knb176336knb-176
    • 2021-10-20
    180 min

    [FUFU-202]When I Went To Get A Sensual Massage Without Telling My Wife ...

  • censoredcreampieamateurFUFUstar paradisefuufuFUFU-202FUFU202h-254fufu00202
    • 2021-11-20
    138 min

    [CEMD-089]Wet Anal SEX! Akari Niimura ~Cumming So Many Times With Booze And Anal!

  • akari shinmura censoredanalbig titsCEMDceleb no tomoCEMD-089CEMD089cemd00089
    • 2021-11-26
    278 min

    [360MBMS-023]素人ホイホイ×MBM このルックスに、この爆乳！！神が与えた奇跡 1000人に1人の逸材 爆乳素人 4 撮り下ろし3名

  • amateur censoredbig titsamateurmbmsmbms-023mbms023360mbms-023
    • 2021-12-03
    120 min

    [MIAA-541]She Hated Her Boss, But His C*ck Simply Hit The Spot, Way Too Well ... And After He Made Her Cum So Hard She Could Die, They Hungered For Each Other With Second Helping Creampie Sex Yumeru Kotoishi

  • yume kotoishi censoredcreampieblowjobMIAAmoody smamezawa mametaroeveryone s kikatanMIAA-541MIAA541miaa00541
    • 2022-01-02
    53 min

    188HINT-0502 Keiko 2

  • amateur censoredamateurmature womanhinthint-0502hint0502188hint-0502
    • 2022-01-15
    142 min

    [TNOZ-011]Amazing Tits 111cm Cosplayer, Age 19 (Everyone Gets A Tongue Job And French Kiss Cleanup) Super Sensitive Masochist (Squirting Hard With Orgasmic Nipple Play) (Non-stop Mouth Fucking For Gagging With Lots Of Drool And Love Juice All Around

  • censoredbig titssquirtingTNOZall japan amateur photographers union daydream fantasy loversspit uncle 2 all japan kameko cooperative daydream tribeTNOZ-011TNOZ011tnoz00011
    • 2022-01-22
    244 min

    [UMSO-431]Hired For An Outcall, The Door Opens And The Man Waiting For Her Is The Friend Of A Friend!! She Knows She Shouldn"t Fuck Him, But There"s Just Something About Him, So Maybe Just Once!!

  • flowers kimishima mio censoredbig titsUMSOk m produceumanamiUMSO-431UMSO431umso00431
    • 2022-02-11
    40 min

    FC2PPV 2660181 [In Search Of A Married Woman] <Resident In A Rural Area> A Beautiful Wife Who Is Hungry For A Cock With A Super Lascivious Face And 3p Cum Shot Continuous Injection! I Thoroughly Enjoyed The Shit Erotic Face And Fellatio.

  • amateur uncensoredfc2
    • 2022-02-19
    179 min

    [AMOZ-087]Is It True That She Wants To Be Seen More!？ This Housewife Agreed To Become An Underwear Model, And Now She"s Showing Off Even More Daring Poses, The Kind She Would Never Dare Show To Her Husband! Raw Fucking Sex With 9 Ladies Whose Bod

  • censoredcreampieamateurAMOZamateur box daydreamamateur boxAMOZ-087AMOZ087amoz00087
    • 2022-02-26
    140 min

    [YMDD-267]Fabulous Big-Breasted Sisters. Two Sisters At A Top-Class Massage Parlor.

  • censoredYMDDmomotaro eizodukewakamomoYMDD-267YMDD267ymdd00267



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored