censored javcensored tall jav high vision




FC2AUKGDTTAWDVEMACAWDSTARSAVSAMEYDAUKSGVHNACRWANZIPXMIAAWAAASSNIMARANATRFSDSSPRED

2019-11-22
188 min

[ABP-925]You Can Really Fuck These Girls？! - The Legendary Pink Salon 13 - Get Your Fill Of A Tall Girl With Big Tits! - Reina Kashima

  • reina kashima censoredcreampiecosplayABPprestigemasaru pantherabsolutely perfectABP-925ABP925118abp00925
    • 2019-11-21
    155 min

    [FSDSS-003]A Fresh Face A FALENO Star Exclusive A Sex Goddess Has Cum Upo Us Her Adult Video Debut Suzume Mino

  • suzume mino censoredbig titssingle workFSDSSfalenofaleno starFSDSS-003FSDSS0031fsdss00003
    • 2019-11-20
    120 min

    [ARM-815]Garter Belt Wrapped Thighs x Thigh Fucking 3

  • ichinose love himari ogawa censoredslutARMaroma planningshigeo kadowakiaromaARM-815ARM815arm00815
    • 2019-11-19
    115 min

    [STARS-157]I'm So Obsessed With Suzu Honjo, I Summoned Her As A Succubus

  • suzu honjo censoredcreampiesingle workSTARSsod createzampasod starSTARS-157STARS1571stars00157
    • 2019-11-15
    148 min

    [TIKP-039]A Beautiful Married Woman With An Incredibly Erotic Body - Iroha Maeda

  • maeda iroha censoredcreampiebig titsTIKPtikitiki.comerTIKP-039TIKP039tikp00039
    • 2019-11-14
    119 min

    [SSNI-624]3 Years Ago My Lady Boss Retired To Get Married, But Now That She's Back, I Spent 3 Days At A Hotel During My Business Trip Fucking Her Brains Out, And Here's The Video Record To Prove It Ichika Hoshimiya

  • ichika hoshimiya censoredsingle workSSNIs one number one stylemeat respects1 no 1 styleSSNI-624SSNI624ssni00624
    • 2019-11-14
    180 min

    [FFFS-011]We're Bringing Back A Mature Woman! A Married Woman Who Likes Playing With Other Men's Cocks A Complete POV Documentary 8 A Horny Forty-Something Slut Wife Maki-san (40 Years Old, Tanned), F-Cup Titties Chiaki-san (41 Years Old, Big

  • censoredmature womanFFFSmature woman private videos emmanuelleprivate private the daydreamersFFFS-011FFFS011fffs00011
    • 2019-11-12
    127 min

    [FONE-089]A 180cm Tall Big Woman Food Fighter Her Shocking Adult Video Debut Nagami Kinoshita This Slutty Bitch Is Hungry For Food And Sex, And Ready To Mow Down 300 Dicks

  • emi kinoshita censoredamateursingle workFONEfirst starplus first starFONE-089FONE089h-491fone00089
    • 2019-11-09
    151 min

    [EYAN-144]A Housewife With Ultra Squishy Pale And Slimy Big Tits She's An Exhibitionist Who Loves To Show Off Her Cleavage And Wait For Nampa Artists To Pick Her Up! And Then It's Off For Some Raw Lusty Fucking Honoka-san A 172cm Tall Girl

  • censoredcreampiebig titsEYANe bodywives of hanasagariEYAN-144EYAN144eyan00144
    • 2019-11-09
    149 min

    [JUFE-117]My Girlfriend Is Close By But Her Intellectual Little Sister Is Whispering Dirty Talk And Pressing Her Beautiful Tits Against Me In An Attempt To Lure Me To Temptation, What A Dirty Fucking Slut Kanon Kanade

  • kanon kanon meiko nakao noa censoredcreampieslutJUFEfitchJUFE-117JUFE117jufe00117
    • 2019-11-08
    124 min

    [MKMP-304]A Fresh Face The Discovery Of A 171cm Tall And Overwhelmingly Slender Beautiful Girl Her Adult Video Debut Haru Yamaguchi

  • yoko yamaguchi censoredbeautiful girlsingle workMKMPk m producehiroshi nikumarumillionMKMP-304MKMP30484mkmp00304
    • 2019-11-03
    150 min

    [KTB-026]I've Got Pants Too! - Bukkake - OL Suits Club 15 - College Girl Intern Kanon-san Shows Off Her Favorite Miniskirt And A Sexy Pant Suit - Kanon Nakajou

  • nakajo canon censoredsingle workbukkakeKTBkahanshin tigers mousouzokukahanshin tigersKTB-026KTB026ktb00026
    • 2019-11-01
    131 min

    [CHN-177]Renting New Beautiful Women 92 Arare Mochizuki (Porn Actress) 21 Years Old

  • mochizuki hail censoredcosplaybeautiful girlCHNprestigemanhattan kimuralendingCHN-177CHN177118chn00177
    • 2019-11-01
    241 min

    [FIV-052]***** 5-Star Channel Tall And Glamorous Special Ch.38 Exquisite Sex With A Beautiful Lady With Model Good Looks

  • censoredbig titssquirtingFIVprestigefive starsFIV-052FIV052118fiv00052
    • 2019-11-01
    128 min

    [BNST-006]A Fresh Face Sasha This Russian Beauty Loves Japanese Adult Videos So Much She Came To Japan For A Quickie Adult Video Debut

  • censoredBNSTteacher delusion groupBNST-006BNST006bnst00006
    • 2019-11-01
    112 min

    [HDKA-189]The Naked Yoga Instructor Kiriko Imafuji

  • kiriko imato censoredcreampiebig titsHDKAplanet plusbirdman teppeinudityHDKA-189HDKA189h-237hdka00189
    • 2019-10-25
    179 min

    [SABA-568]I Pretended To Be Offering Massage Services From Out Of My House, And Invited A Beautiful Married Woman Who Lived In A Nearby Apartment Building Inside, And I Skillfully Convinced Her To Have Pleasure-Filled Sex With Me

  • censoredcreampiebig titsSABAskyu shirotoSABA-568SABA568h-244saba00568
    • 2019-10-25
    149 min

    [SABA-570]He'll Manage You Career And His Recommendation Is His Word, And Every Lady He Picks Is A Winner!

  • censoredamateurSABAskyu shirotoSABA-570SABA570h-244saba00570
    • 2019-10-22
    140 min

    [STARS-143]Piston-Pumping Thrusts For Continuous Orgasmic Numbing Sex Maria Wakui

  • maria wakui censoredsquirtingsingle workSTARSsod createmon csod starSTARS-143STARS1431stars00143
    • 2019-10-19
    119 min

    [CJOD-210]If This Girl Has 15 Minutes To Spare, She's Fucking, And Now She's Making Her Adult Video Debut! Mirai Shintani

  • mirai shintani censoredslutsingle workCJODchijo heavenCJOD-210CJOD210cjod00210
    • 2019-10-13
    138 min

    [TIKB-057]God Specs: I Gave Aphrodisiacs To A 180cm Slender-Legged Super-Stylish Gal And She Let Me Fuck Her Without A Rubber - Elle Sato

  • sato l censoredcreampiesingle workTIKBtikitiki.comerTIKB-057TIKB057tikb00057
    • 2019-10-12
    182 min

    [FFFS-010]Bring On The Mature Ladies! Married Woman Playing With Another Man's Cock: Voyeur Documentary: 7 In Total: Big Tits H-Cup Wife Affair Edition - Miss Eri (41) H-Cup & Miss Izumi (40) H-Cup

  • censoredbig titsmature womanFFFSmature woman private videos emmanuelleprivate private the daydreamersFFFS-010FFFS010fffs00010
    • 2019-10-12
    186 min

    [JJBK-025]Mature Woman Babes Only A Mature Woman Came To My Room Take Them Home For Some Peeping Video Sex And Then We'll Sell The Footage As An Adult Video 23 A Forty-Something Tall Lady With Colossal Tits Twin Towers Height: 175cm/Emiko-san/H-C

  • censoredmature womanJJBKjukujo bank emmanuellemature woman bankJJBK-025JJBK025jjbk00025
    • 2019-10-11
    160 min

    [REAL-708]I Want To Get Fucked By A Big Woman A Super Tall Amazon Nanako Takamiya

  • nanako miyamura censoredblowjobslutREALreal worksuzumaki sasakireal real worksREAL-708REAL708172real00708
    • 2019-10-06
    119 min

    [MIAA-166]Super VIP - 180cm Tall Tattooed Beauty Provides The Highest Quality Creampie Soapland Service - Eru Sato

  • sato l censoredcreampiebeautiful girlMIAAmoody scameleveryone s kikatanMIAA-166MIAA166miaa00166
    • 2019-10-03
    170 min

    [PRED-192]175cm Tall 9.5 Heads Tall A Real-Life Event Hostess Makes Her Adult Video Debut! Mirai Shintani

  • mirai shintani censoredamateurblowjobPREDpremiumzampaelegancePRED-192PRED192pred00192
    • 2019-09-27
    112 min

    [HZGD-127]Married Woman Violated And Creampied Over And Over By Despicable Neighbor Mika Kurosaki

  • kurosaki mika censoredcreampiebig titsHZGDmarried woman flower garden theaterzampaimage married woman flower garden theatHZGD-127HZGD127h-1100hzgd00127
    • 2019-09-26
    48 min

    [AKDL-001]A 148cm Tall Beautiful Girl x A 100kg Massively Endowed Orc A Six-Way Hard-Press Impregnation Orgy Fuck Fest Hikaru Minazuki

  • hikaru minazuki censoredcreampieschoolgirlAKDLakinori10 000 tons of sugaraknrAKDL-001AKDL0011akdl00001
    • 2019-09-24
    134 min

    [STARS-125]Long Arms and Legs Touch The Whole Body - Men's Spider Massage Parlor Suzu Honjo

  • suzu honjo censoredsingle workSTARSsod createhirokoji osakisod starSTARS-125STARS1251stars00125
    • 2019-09-22
    113 min

    [BLOR-130]A Cute And Gentle-Looking Tall Girl Student Voluptuous Big Tits! And She's A Maso Bitch! She's Drooling For Mind-Blowing Deep Throat Dick-Sucking Pleasure!

  • censoredbig titsBLORbroccoli mousouzokubroccolibroccoliBLOR-130BLOR130blor00130
    • 2019-09-21
    161 min

    [JUY-977]A Former System Engineer An Exquisitely Glamorous And Intelligent Married Woman Iroha Maeda 28 Years Old Her Adult Video Debut!! When She Feels Good, She Unconsciously Starts Rolling Out Her Tongue.

  • maeda iroha censoredbig titsmature womanJUYmadonnajo styleJUY-977JUY977juy00977
    • 2019-09-21
    169 min

    [AKID-066]College Girl Babes Only After The Party, We Took Her Home To Film Some Peeping Videos And Then We Sold The Footage Without Permission As An Adult Video No.30 Slut Babes And Mature College Girl Edition Reiko/E-Cup Titties/21 Years Old Yuna/H

  • censoredAKIDomochikaeri mousouzokutake outAKID-066AKID066akid00066
    • 2019-09-15
    132 min

    [LZPL-044]The Ultimate Body The Lesbian Porn Temptation Of An Orgasmic Woman 2 Miori Ayaha Saryu Usui

  • ayaba miori sakisui censoredlesbianLZPLlesrebarbie glezure playLZPL-044LZPL044lzpl00044
    • 2019-09-14
    162 min

    [FFFS-009]Mature Woman Pickup! Married Woman Play With Other Men's Cocks - A Complete Voyeur Documentary - Tall Women! Colossal Tits! Married Women With A Healthy Tan! - Mai, 43, I-Cup - Misae, 40, H-Cup

  • censoredmature womanFFFSmature woman private videos emmanuelleprivate private the daydreamersFFFS-009FFFS009fffs00009
    • 2019-09-13
    125 min

    [XRW-742]Aphrodisiacs And Power Tools - Endless Orgasms - Lulia Ichinose

  • rin ichinose censoredsquirtingsingle workXRWreal workshide kingreal real worksXRW-742XRW742172xrw00742
    • 2019-09-09
    150 min

    [KTFT-001]A Woman Who Fell Into A Molestation Auction: Female Editor Reiko Sawamura

  • reiko sawamura honami takasaka masumi takasaka censoredmature womansingle workKTFTkahanshin tigers mousouzokukahanshin tigersthe kahanshin tigersKTFT-001KTFT001ktft00001
    • 2019-09-09
    129 min

    [BAVC-002]Sexual Gratification Sumire Is Inviting Emotion With Her Plump Butt: Sumire Kurokawa

  • sumire kurokawa censoredsingle workBAVCbaltanspilma boyvictoriaBAVC-002BAVC002bavc00002
    • 2019-09-08
    150 min

    [EBOD-710]She's 171cm Tall With Long Arms And Legs She's Got The Hottest Body In Japan She's Appeared In Famous Girls Collection Model Shows A Tall Girl Model With Beautiful Legs Her Adult Video Debut

  • censoredbig titssquirtingEBODe bodyEBOD-710EBOD710ebod00710
    • 2019-09-07
    118 min

    [MXGS-1097]This Young Wife Is A Tall Girl With Beautiful Legs Who Is Super Horny And Is Getting Fucked In The Afternoon By The Horny Dirty Old Man From Next Door Nanako Miyamura

  • nanako miyamura censoredsingle workMXGSmaxingMXGS-1097MXGS1097h-068mxgs01097
    • 2019-09-06
    144 min

    [KTB-024]Bukkake! Women In Business Suits 14 - A Tall Girl Commits Reverse Sexual Harassment At The Office In Her Tight Suit And Striped Skirt - Shoko Otani

  • shoko otani censoredslutsingle workKTBkahanshin tigers mousouzokukahanshin tigersKTB-024KTB024ktb00024
    • 2019-09-05
    164 min

    [NGOD-109]A Housewife With A Probationary Driver's License Please Give Me Your Stamp Of Approval... Reiko Sawamura

  • reiko sawamura honami takasaka masumi takasaka censoredbig titsmature womanNGODjet eizoNGOD-109NGOD109ngod00109
    • 2019-09-05
    157 min

    [SSNI-560]Total Domain Tall Girl Flashes Her Sexy Legs - A Nympho In Knee Highs Hotaru Nogi

  • nogi firefly censoredschoolgirlsingle workSSNIs1 no 1 stylegoemonSSNI-560SSNI560ssni00560
    • 2019-08-31
    157 min

    [JUFE-094]She'll Hold You Tight And Lick You All Over A Drooling, Sucking Slut Mari Takasugi

  • mari takasugi censoredcreampiebig titsJUFEfitchJUFE-094JUFE094jufe00094
    • 2019-08-30
    126 min

    [DTT-034]Sexless And Gagging For It - A 30-Year-Old Married Woman With Beautiful Legs Who Works As A Calligraphy Teacher -

  • shiroyama wakana censoredbig titssingle workDTTprestigemasaru pantherkanbiDTT-034DTT034118dtt00034
    • 2019-08-25
    133 min

    [AVSA-096]A Shameful Power Harassment Slut Drama A Beautiful Lady Boss Who Abuses Her Power Reiko Kobayakawa

  • kobayakawa reiko censoredmature womanslutAVSAavs collector siceman ochiaiavscollector sAVSA-096AVSA096avsa00096
    • 2019-08-23
    149 min

    [DOMD-004]"I Know You Like Big Girls!" - A Beautiful, Tall, Sexy Woman... With Her Queen-Like Looks, Sadistic Attitude That Attracts Masochistic Men, Her Sweet Voice And Her Experienced Hands, She Rides On Top Of Guys And Makes All Their Drea

  • oba yui takigawa kanon censoredblowjobslutDOMDdream ticketDOMD-004DOMD00424domd00004
    • 2019-08-22
    130 min

    [KMHR-069]I Went To A Sex Club And Crossed The Line And Fell In Love Because You Made Me Feel So Good Arare Mochizuki

  • mochizuki hail censoredsingle workKMHRsod createmichiru arashiyamai fell in love with youKMHR-069KMHR0691kmhr00069
    • 2019-08-20
    190 min

    [STARS-110]Midnight Endless Orgasms Suzu Honjo

  • suzu honjo censoredsingle workSTARSsod createtrendy yamaguchisod starSTARS-110STARS1101stars00110
    • 2019-08-17
    162 min

    [MMYM-031]Obscene Woman - Honoka Takigawa

  • honoka takikawa censoredmature womansingle workMMYMmarrionaida yumenoyumenoMMYM-031MMYM031mmym00031
    • 2019-08-16
    135 min

    [DKN-012]She Started Working As A Cabin Attendant At A Recently Commissioned Low-Cost Airline 167cm Tall G-Cup Titties This Tall Big Tits Beauty Is A Genuine Horny Slut Who Becomes Unstoppable Once She Falls For The Sins Of Pleasure

  • censoredcreampiebig titsDKNprestigedockingDKN-012DKN012118dkn00012
    • 2019-08-12
    142 min

    [MONE-011]A Sexy Cool Lady With Nice Long Legs - 171cm Tall - Karen Chujo

  • nakamine karen censoredcreampiesingle workMONEmercurybirdman teppeia fair skinned elder sisterMONE-011MONE011h-1133mone00011
    • 2019-08-09
    181 min

    [XRW-732]Making My Tall, Proud And Aspirational Female Boss Give Deep Throat!! Honoka Takigawa

  • honoka takikawa censoredcreampiedeepthroatXRWreal worksreal real worksXRW-732XRW732172xrw00732
    • 2019-08-09
    168 min

    [ZMEN-024]My Female Boss's Pantyhose Is Giving Me A Boner! I Couldn't Control Myself So I Rubbed Myself Against Her And She Was Dripping Wet... 2

  • ririka rio okita censoredZMENz mengoro koenjiZMEN-024ZMEN024h-1371zmen00024
    • 2019-08-03
    170 min

    [SSNI-535]A Tall Cabin Attendent With Beautiful Legs Gets Gang Banged Every Day Until She's Completely Broken In - Rikka Inui

  • dry censoreddeepthroatsingle workSSNIs1 no 1 stylebungo maedaSSNI-535SSNI535ssni00535
    • 2019-08-02
    136 min

    [DOKS-492]Addicted To Kisses A Long-Tongued Perverted Slut Lenon Kanae

  • kanae lennon censoredslutlingerieDOKSoffice k somaruDOKS-492DOKS49236doks00492
    • 2019-08-02
    117 min

    [NITR-460]A Horny Bad Boy Goes Big Tits Housewife Hunting VI Eriko Nakanishi

  • eriko nakanishi censoredbig titsmature womanNITRcrystal eizobuddha dnitroNITR-460NITR46049nitr00460



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored