censored mature woman high vision jav amateur




FC2KBISDABNATRHODVJULSSNIDTTROYDHDKAHMNMIAADASDHNDMIDEFSDSSVENXVEMAAVSAAUKGIPX

2020-09-17
124 min

[JRZD-991]Entering The Biz At 50! Makiko Tsurukawa

  • makiko tsurukawa censoredcreampiemature womanJRZDcenter villagedaichi minamijurakuJRZD-991JRZD991h-086jrzd00991
    • 2020-09-27
    119 min

    [BIJN-186]THE DOCUMENTARY Basic Instinct-Baring Orgasmic Sex Voluptuous And Meaty x Horny As Fuck x Maso Lust A Beautiful Married Woman Awakens Her Pleasure Principles Through A Sweaty Orgasmic Loop Of Infinite Sex Yuka Hirose

  • yuka hirose censoredmature womansingle workBIJNbijin majo emmanuelleBIJN-186BIJN186bijn00186
    • 2020-10-09
    150 min

    [MKMP-356]Cum Buckets! -Massive Loads Of Facials And Squirting - Threesome Sex- Nako Hoshi

  • nako hoshi censoredsquirtingbeautiful girlMKMPkm producekaorumillionMKMP-356MKMP35684mkmp00356
    • 2020-10-10
    133 min

    [MEYD-627]While My Husband Takes A 5 Minute Smoke Break, My Father-In-Law Gives Me A Pregnancy Fetish Creampie Quickie, 10 Times A Day... Rei Kuruki

  • satoshi kuruki censoredcreampiesingle workMEYDtameike gororokusaburo mishimaMEYD-627MEYD627meyd00627
    • 2020-10-10
    147 min

    [MIAA-333]Cheating With Her Hugely Hung Coworker... Nene Tanaka

  • nene tanaka censoredcreampiebig titsMIAAmoodyzmametaro mamezawaeveryone s porn starMIAA-333MIAA333miaa00333
    • 2020-10-10
    145 min

    [EBOD-768]She's Lifting Her Creampie Ban! A 2-Day, 1-Night, 10 Ejaculation Orgasm Creampie Sex-Filled Vacation With A Horny Old Man And His Raw Cock Rina Asuka

  • asuka riina censoredcreampiebig titsEBODe bodytake dEBOD-768EBOD768ebod00768
    • 2020-10-12
    65 min

    328HMDN-302 [Personal shooting] Joined the company this spring! Yua-chan, a 22-year-old pussy girl who has been raised since she was a virgin ♪ I grew up in a hurry ♀ I’m soaking naked as a employment celebration I’m going out in a love hot

  • amateur censoredcreampiebig titshmdnhmdn-302hmdn302328hmdn-302
    • 2020-10-20
    139 min

    [STARS-292]In Bed All Day For Relentless, Sticky Piston Creampie Sex Mahiro Tadai

  • mahiro yui censoredcreampiesingle workSTARSsod createbacon tanakasod starSTARS-292STARS2921stars00292
    • 2020-10-22
    57 min

    [H4610-ki201022]小畑 彩音 20歳

  • amateur uncensoredh4610
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-10-27
    206 min

    [HONB-192](Video) I Met This Ultra, Ultra High-Level, Super Cute Beautiful Girl At The Park And She Seriously Gave Me A Hard On And I Took Her To The Bathroom And She Sucked My Dick And I Ejaculated A Massive Cum Face Semen Splatter On Her (# ^ ^ #)

  • censoredcreampieuniformHONBmercurythe first shibuya special f e headquarHONB-192HONB192h-1133honb00192
    • 2020-11-01
    240 min

    [SCR-256]Totally Private Salon - Posting Personal Footage, Highlights Collection - 4 Hours - Every Single Customer Comes Back For More - Do You Indulge In Illicit Sex Or Not？ It's All Up To You-

  • censoredcreampieblowjobSCRglay zs crimeSCR-256SCR25612scr00256
    • 2020-11-07
    153 min

    [TSF-007]When You Wake Up In The Morning, You'll Be Transformed Into A Girl This Male S*****t Was Transformed Into A Girl, And We Did A Thorough Study It Appears He Fell In Love With His New Face, And Believes The Theory That "He Switched Pla

  • kumano tree censoredcreampiebeautiful girlTSFkaguyahimept mousouzokugynecomastia reportTSF-007TSF007tsf00007
    • 2020-11-16
    119 min

    [MMRAB-051]せくしい美少女Teen’s図鑑ギリギリ限界DX

  • emma nakajima kiryu nananoha censoredMMRABspice visualmareMMRAB-051MMRAB051406mmrab00051
    • 2020-12-10
    94 min

    FC2PPV 1600511 039 [12 Dopyu Massive Facials] Will JD4, who is about to graduate from college, climb the adult stairs toward working adults？

  • amateur uncensoredfc2
    • 2020-12-15
    134 min

    [SDAB-158]Continuous Creampie Fucks - Soapland Brothel Festival Hana Himesaki

  • himesaki hana censoredcreampiebig titsSDABsod createzaku araione s youthSDAB-158SDAB1581sdab00158
    • 2020-12-18
    197 min

    [GNAB-043]We All Missed The Last Train Home So I Spent The Night At A Love Hotel With My Best Friends - Who Are Dating! The Girlfriend Of The Couple Started Making Eyes At Me, Then Teasing Me, And Finally Told Me "It's Okay, Go On" And We

  • censoredcreampieamateurGNABprestigehimrockbang prestigeGNAB-043GNAB043118gnab00043
    • 2020-12-18
    94 min

    [MBDD-2050]Yume Nikaido In Dirty Diva

  • nikaido yume censoredbeautiful girlMBDDmedia brandMBDD-2050MBDD2050301mbdd02050
    • 2021-01-10
    135 min

    [AVSA-151]SUPER FISHEYE FETISHISM Extreme Erotic Closeups - Office Girl's Voluptuous Curves Kaho Imai

  • natsuho imai censoredsingle workAVSAavs collector sbuddha davscollector sAVSA-151AVSA151avsa00151
    • 2021-01-14
    242 min

    [CVDX-431]Pussies Spread Wide! Exhibitionist Fucks Right Under The Open Sky - Married Sluts Take Golden Showers! 28 Girls, 4 Hours

  • censoredmature womanCVDXcenter villageCVDX-431CVDX431h-086cvdx00431
    • 2021-01-19
    380 min

    [MSFH-048]Transcendental Man And Woman Cum Together Until They Are Exhausted - Bishin Mizusawa

  • mizusawa beauty censoredcreampiebig titsMSFHsod createzaku araims sodMSFH-048MSFH0481msfh00048
    • 2021-01-28
    60 min

    10musume 013021_01 The Structure Of Woman : Please Measure My Round Areola Umi Fujisawa

  • amateur uncensored10musume
    • 2021-01-29
    50 min

    [MASE-013]Housewife Wakana Ravish In Her Own Kitchen! Married Woman Trembles As She's Tied Up, Blindfolded, And Made To Fuck A Stranger!

  • censoredcreampiebig titsMASEcrystal picturemadam maniac plusMASE-013MASE01349mase00013
    • 2021-01-29
    43 min

    [per-361]ここみ

  • amateur censoredamateurperper-361per361per-361
    • 2021-01-29
    242 min

    [MDBK-156]童顔で身体は超ボイン！！ベビーフェイスでぷるんぷるんオッパイ30人のロ●巨乳BEST240分！！

  • inaba yuuri censoredcreampiebig titsMDBKk m producek taroubazookaMDBK-156MDBK156h-1496mdbk00156
    • 2021-02-01
    124 min

    [GOJU-177]"I May Be In My Fifties, But I Still Want To Keep On Fucking." She Wants To Release Her Wealth Of Sexual Knowledge, And So Now, This Beautiful Mature Woman Has Mustered Up Her Courage And Decided To Star In This Adult Video Megumi-s

  • censoredamateurmature womanGOJUfifty somethingGOJU-177GOJU177h-1165goju00177
    • 2021-02-13
    300 min

    [DVAJ-501]A Two-round Intercourse With An Ultimate Beauty Who Won't Stop Even After You've Cum Once

  • hasumi claire sachiko censoredslutDVAJalicerabbit kandaDVAJ-501DVAJ501dvaj00501
    • 2021-02-16
    64 min

    Pacopacomama 021621_435 This hot wife used to be a model Risa Aikawa

  • amateur uncensoredpacopacomama
    • 2021-02-19
    118 min

    [KUM-013]Undercover Female Detective 02

  • censoredbig titsbdsmKUMprestigejanhirokyuryu prestigeKUM-013KUM013118kum00013
    • 2021-03-03
    108 min

    [mgmr-132]HINA(26)

  • amateur censoredamateurbeautiful girlmgmrmgmr-132mgmr132mgmr-132
    • 2021-03-21
    78 min

    [scute-1103]ひなこ(20)

  • amateur censoredamateurblowjobscutescute-1103scute1103scute-1103
    • 2021-03-30
    86 min

    FC2PPV 1747334 980 yen! [During the first life] Just before the Gei 〇 office contract! !! I took off the rubber while shooting by myself and got vaginal cum shot from raw etch! The face is bright red and the vulgar Ahegao is exposed and dies! !! 20 y

  • amateur uncensoredfc2
    • 2021-04-02
    115 min

    [JUL-536]An Adultery Trip Disguised As A Business Trip Ayaka Muto

  • ayaka muto censoredcreampiebig titsJULmadonnamametaro mamezawaJUL-536JUL536jul00536
    • 2021-04-20
    99 min

    261ARA-485 [Overwhelming beautiful girl] 24 years old [I want to live in heaven] Mio-chan is here! The reason for her application, which usually works at a pizza shop, is "I’m dissatisfied with my boyfriend’s sex …" Inflexible

  • amateur censoredamateurbeautiful girlaraara-485ara485261ara-485
    • 2021-05-01
    103 min

    [ADN-317]I Fucked Miss Yuka My Homeroom Teacher - The Two Days I Can Never Tell Anyone About. Iroha Natsume

  • natsume saiharu censoredsingle workdramaADNattackersnaotootona no dramaADN-317ADN317adn00317
    • 2021-05-02
    51 min

    188HINT-0452 Ruri

  • amateur censoredmarried womansquirtinghinthint-0452hint0452188hint-0452
    • 2021-05-06
    142 min

    [SPRD-1407]I Learned That My Wife Was Fucked By Both My Step Father And Step Brother... Mayu Suzuki

  • suzuki mayu censoredsingle workSPRDtakara eizoutakara hiroshialeddinSPRD-1407SPRD140718sprd01407
    • 2021-06-04
    221 min

    [PRED-314]4th Anniversary - We Love Aika - Living The Newlywed Lifestyle With Aika Yamagishi - When You Wake Up In The Morning, Aika Is Right Beside You, Smiling, Strolling, Laughing, Bathing, And Of Course, Making Love In This Pure But Sensual Foota

  • aika yamagishi censoredcreampiesingle workPREDpremiumhiromichi hoseelegancePRED-314PRED314pred00314
    • 2021-07-02
    98 min

    [ADN-327]Forgive Me, Darling... The Pitfalls Of Age-Gap Marriages Natsu Tojo

  • natsu tojo censoredsingle workdramaADNattackersnagira kenzootona no dramaADN-327ADN327adn00327
    • 2021-07-10
    124 min

    [MOPT-009]Submissive Men Are Made To Be Tied Up. Slut Turned On By Bondage. Mary Tachibana

  • tachibana mary censoredanalslutMOPTm o paradisemo tightMOPT-009MOPT009mopt00009
    • 2021-07-14
    125 min

    [ARM-998]Girls Give Jerk Off Instructions In Thongs Before Showing Off What's Underneath

  • blue ai kawana censoredanalARMaroma planningmania satoshiaromaARM-998ARM998arm00998
    • 2021-07-19
    25 min

    FC2PPV 1930708 [Personal Shooting / Creampie] Mature Wife Who Feels Everywhere In Her Body Feels Tingling And Trembles In Small Steps …

  • amateur uncensoredfc2
    • 2021-08-21
    241 min

    [MKMP-412]All-Power Squirtfest With 50 Sexy Idols! Serious Amounts of Squirting 240 Minutes Best-Of Compilation

  • miku abe chiharu miyazawa censoredsquirtingbeautiful girlMKMPk m producek taroumillionMKMP-412MKMP412mkmp00412
    • 2021-09-11
    133 min

    [CEAD-361]I Am A Pleasure-mad Nasty Maturbator 20 - Rin Kira

  • kira rin censoredmature womansingle workCEADserebu no tomoCEAD-361CEAD361cead00361
    • 2021-10-02
    81 min

    300NTK-641 [Sorry Echona Beautiful Breasts JD X Echi Echi G Breasts JD Is A Dream Competition In The Open Air! !! ] The Open-Air Bath Where Both The Propensity And The Beautiful Body Are Fully Exposed. !! Echiachi Gangbang Sp! !! Intrinsic De Nasty E

  • amateur censoredcreampiesquirtingntkntk-641ntk641300ntk-641
    • 2021-10-10
    63 min

    300NTK-645 [Underground Idols #God Body #Tall G Breasts And Individual Shooting In Love Hotel! !! ] G Milk Glamorous God Body Hissage Love Hotel Individual Shooting! !! It Should Be Strictly Prohibited To Touch … Immediate Squirting From The Lif

  • ssrgsex censoredcreampiebig titsntkntk-645ntk645300ntk-645
    • 2021-10-15
    238 min

    [MUCD-253]These Pure And Innocent Beautiful Girl Babes Will Bless You With Nipple Licking Handjob Action Licky Licky Squish Squish They Just Learned These Skills And Now You"re Receiving A Double Dose, And When You Can No Longer Endure It, Go Ahe

  • rena kiyomoto yuuna himekawa ran tsukishiro censoredschoolgirlblowjobMUCDmukuMUCD-253MUCD253mucd00253
    • 2021-11-06
    152 min

    [SCOP-745]This Is The Truth I Discovered When I Ordered A Delivery Health Call Girl!! My Neighbor In Our Apartment Complex Is Usually A Quiet And Shy Lady, But One Night, She Appeared At My Door As A Furiously Vulgar And Horny Big Tits Delivery Healt

  • censoredbig titsblowjobSCOPk m producejoni shibuyascoop kmpSCOP-745SCOP745scop00745
    • 2021-11-18
    65 min

    200GANA-2591 Seriously Nampa, First Shot. 1716 Dental Assistant Found In Yokohama! The Body Line Projected By The Knit Dress Is Too Erotic … It’S A Nice Atmosphere To Date And Go To The Haste Hotel! If You Take It Off, It’S The Best Bo

  • amateur censoredbig titssquirtingganagana-2591gana2591200gana-2591
    • 2021-11-20
    61 min

    1Pondo 112021_001 The Throbbing: My Girlfriend Loves Giving Me a Head Early in the Morning Remi Fuyutsuki

  • amateur uncensored1pondo
    • 2021-12-01
    120 min

    [AMBI-144]I Want To Do It With You!! Sexy Little Sister-In-Law Continues To Provoke Brother-In-Law Mitsuki Nagisa

  • scooping censoredcreampiebeautiful girlAMBIplanet plusbito sakuraanbibaresotsuAMBI-144AMBI144h-237ambi00144
    • 2021-12-31
    126 min

    [RBK-034]A Showroom Of Sluts. Anal Sex For The Deceived New Wife. Moe Hazuki

  • moe hazuki censoredanalsingle workRBKattackerskaoru okuzonoryupakuRBK-034RBK034rbk00034
    • 2022-01-13
    63 min

    336KNB-188 [AV Appearance As Soon As The Newlyweds! ？？ ] A Rough Chin Husband Below The Middle Finger, But I Wanted You To Hold Me Because It’S Okay … That’S Why I Appeared In Av! !! It’S Been A Long Time Since I Was Stabbed In Th

  • amateur censoredmarried womanamateurknbknb-188knb188336knb-188
    • 2022-01-22
    178 min

    [DGCEMD-119]-Online Only! Includes Bonus Footage- Stepmom/Stepdaughter Lesbians - Ayaka Mochizuki, Kayo Iwasawa - One Naughty Stepdaughter Can"t Get Enough Anal From Her Freaky Stepmom!

  • ayaka mochizuki kayo iwasawa censoredbig titslesbianDGCEMDcelebrity friendsDGCEMD-119DGCEMD119dgcemd00119
    • 2022-02-05
    59 min

    1Pondo 020522_001 Happening Occurs During Live Streaming! Mai Shirakawa

  • amateur uncensored1pondo
    • 2022-02-12
    135 min

    [TIKB-131](Sex Log) I Let This Gal Have A Sip And She Turned Into A Slut So Huge I Had To Film A POV Video As I Fucked Her

  • censoredcreampieTIKBtikitiki.comerTIKB-131TIKB131tikb00131



    • Jav movie porn full hd, javhd xxx, jav full video sex, japan porn hd, download jav uncensored